Recombinant Full Length Escherichia Fergusonii Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL10959EF |
Product Overview : | Recombinant Full Length Escherichia fergusonii Membrane protein insertase YidC(yidC) Protein (B7LK48) (1-548aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Escherichia fergusonii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-548) |
Form : | Lyophilized powder |
AA Sequence : | MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFILKRGDYAVNVNYNV QNAGEKPLEISTFGQLKQSITLPPYLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; EFER_4002; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | B7LK48 |
◆ Recombinant Proteins | ||
PCDHA13-3785C | Recombinant Chicken PCDHA13 | +Inquiry |
H2AFB3-4533H | Recombinant Human H2AFB3 Protein, GST-tagged | +Inquiry |
STAR-30115TH | Recombinant Human STAR | +Inquiry |
TMEM59-1679C | Recombinant Chicken TMEM59 | +Inquiry |
RELL2-3664R | Recombinant Rhesus Macaque RELL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
TF-321H | Native Human Transferrin Rhodamine | +Inquiry |
PerCP-139 | Native Dinophyceae sp. Peridinin-chlorophyll-protein complex protein | +Inquiry |
Lectin-1838S | Active Native Sambucus Nigra Lectin Protein, Biotinylated | +Inquiry |
C3b-08H | Native Human Complement C3 beta protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KPNA3-4890HCL | Recombinant Human KPNA3 293 Cell Lysate | +Inquiry |
SLC6A5-1704HCL | Recombinant Human SLC6A5 293 Cell Lysate | +Inquiry |
RTN4-2120HCL | Recombinant Human RTN4 293 Cell Lysate | +Inquiry |
STK36-1714HCL | Recombinant Human STK36 cell lysate | +Inquiry |
OLA1-3586HCL | Recombinant Human OLA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket