Recombinant Full Length Escherichia Coli Zinc Transport Protein Zntb(Zntb) Protein, His-Tagged
Cat.No. : | RFL35655EF |
Product Overview : | Recombinant Full Length Escherichia coli Zinc transport protein ZntB(zntB) Protein (C4ZV90) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zntB |
Synonyms | zntB; BWG_1176; Zinc transport protein ZntB |
UniProt ID | C4ZV90 |
◆ Recombinant Proteins | ||
LIG3-26931TH | Recombinant Human LIG3 protein, His-tagged | +Inquiry |
RFL28939TF | Recombinant Full Length Rhomboid-Like Protease 6(Rom6) Protein, His-Tagged | +Inquiry |
RFL5568DF | Recombinant Full Length Dictyostelium Discoideum Transmembrane Protein 50 Homolog(Tmem50) Protein, His-Tagged | +Inquiry |
CD3E & CD3D-2964R | Recombinant Rat CD3E & CD3D protein, lFc &lFc-tagged | +Inquiry |
CDC73-3153M | Recombinant Mouse CDC73 Protein | +Inquiry |
◆ Native Proteins | ||
PLAU-31777TH | Native Human Human SERPINE1 | +Inquiry |
IgG-356B | Native Bovine Gamma Globulin Fraction | +Inquiry |
GG-193R | Native Rat Gamma Globulin protein | +Inquiry |
SERPING1-73H | Native Human C1 Esterase inhibitor | +Inquiry |
TG-37P | Native Porcine TG protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZPBP2-9191HCL | Recombinant Human ZPBP2 293 Cell Lysate | +Inquiry |
C10orf111-8375HCL | Recombinant Human C10orf111 293 Cell Lysate | +Inquiry |
HLCS-5491HCL | Recombinant Human HLCS 293 Cell Lysate | +Inquiry |
GGH-5948HCL | Recombinant Human GGH 293 Cell Lysate | +Inquiry |
PTN-1524MCL | Recombinant Mouse PTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All zntB Products
Required fields are marked with *
My Review for All zntB Products
Required fields are marked with *
0
Inquiry Basket