Recombinant Full Length Escherichia Coli Upf0283 Membrane Protein Ycjf(Ycjf) Protein, His-Tagged
Cat.No. : | RFL1507EF |
Product Overview : | Recombinant Full Length Escherichia coli UPF0283 membrane protein ycjF(ycjF) Protein (B1XCF0) (1-353aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-353) |
Form : | Lyophilized powder |
AA Sequence : | MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAQEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ycjF |
Synonyms | ycjF; ECDH10B_1441; UPF0283 membrane protein YcjF |
UniProt ID | B1XCF0 |
◆ Recombinant Proteins | ||
CELA3A-2845H | Recombinant Human CELA3A protein, His-SUMO-tagged | +Inquiry |
CHCHD2-1531H | Recombinant Human CHCHD2, His-tagged | +Inquiry |
SMNDC1-4433H | Recombinant Human SMNDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL25954AF | Recombinant Full Length Anabaena Variabilis Upf0060 Membrane Protein Ava_2216(Ava_2216) Protein, His-Tagged | +Inquiry |
SMC3-31196TH | Recombinant Human SMC3, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDH2-220H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
ORM1-35H | Native Human Alpha 1 Acid Glycoprotein | +Inquiry |
CGB-29186TH | Native Human CGB | +Inquiry |
slo-01S | Active Native Streptococcus pyogenes Streptolysin O protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOO-8774HCL | Recombinant Human APOO 293 Cell Lysate | +Inquiry |
SCAPER-2004HCL | Recombinant Human SCAPER cell lysate | +Inquiry |
TCEAL4-1749HCL | Recombinant Human TCEAL4 cell lysate | +Inquiry |
MED30-4383HCL | Recombinant Human MED30 293 Cell Lysate | +Inquiry |
TSC1-725HCL | Recombinant Human TSC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ycjF Products
Required fields are marked with *
My Review for All ycjF Products
Required fields are marked with *
0
Inquiry Basket