Recombinant Full Length Escherichia Coli Upf0283 Membrane Protein Ycjf(Ycjf) Protein, His-Tagged
Cat.No. : | RFL28870EF |
Product Overview : | Recombinant Full Length Escherichia coli UPF0283 membrane protein YcjF(ycjF) Protein (C4ZV70) (1-353aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-353) |
Form : | Lyophilized powder |
AA Sequence : | MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAQEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ycjF |
Synonyms | ycjF; BWG_1153; UPF0283 membrane protein YcjF |
UniProt ID | C4ZV70 |
◆ Recombinant Proteins | ||
NSUN5-6225M | Recombinant Mouse NSUN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
KHDC1C-4795M | Recombinant Mouse KHDC1C Protein, His (Fc)-Avi-tagged | +Inquiry |
DKK2-56H | Recombinant Human DKK2 | +Inquiry |
IFNA2-117M | Active Recombinant Monkey Interferon, Alpha 2 | +Inquiry |
RCN3-301362H | Recombinant Human RCN3 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
TSH-10B | Active Native Bovine TSH Protein | +Inquiry |
α-Crystallin-01B | Native Bovine α-Crystallin Protein | +Inquiry |
C1Q-20H | Active Native Human C1q Protein | +Inquiry |
FSH-1564H | Active Native Human Follicle Stimulating Hormone | +Inquiry |
C6-101H | Native Human C6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Thymus-479C | Cat Thymus Lysate, Total Protein | +Inquiry |
ALPI-1596HCL | Recombinant Human ALPI cell lysate | +Inquiry |
BPIFA2-1459HCL | Recombinant Human BPIFA2 cell lysate | +Inquiry |
AADAT-9158HCL | Recombinant Human AADAT 293 Cell Lysate | +Inquiry |
MCF7ADRr-002WCY | Human Breast Adenocarcinoma MCF7ADRr Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ycjF Products
Required fields are marked with *
My Review for All ycjF Products
Required fields are marked with *
0
Inquiry Basket