Recombinant Full Length Escherichia Coli Upf0053 Inner Membrane Protein Ytfl(Ytfl) Protein, His-Tagged
Cat.No. : | RFL21409EF |
Product Overview : | Recombinant Full Length Escherichia coli UPF0053 inner membrane protein ytfL(ytfL) Protein (P0AE45) (1-447aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-447) |
Form : | Lyophilized powder |
AA Sequence : | MLNSILVILCLIAVSAFFSMSEISLAASRKIKLKLLADEGNINAQRVLNMQENPGMFFTV VQIGLNAVAILGGIVGDAAFSPAFHSLFSRYMSAELSEQLSFILSFSLVTGMFILFADLT PKRIGMIAPEAVALRIINPMRFCLYVCTPLVWFFNGLANIIFRIFKLPMVRKDDITSDDI YAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTPRENVIWFDLHEDEQSLKNKVAE HPHSKFLVCNEDIDHIIGYVDSKDLLNRVLANQSLALNSGVQIRNTLIVPDTLTLSEALE SFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMGDLVGQGLEEQIVARDENSWLIDGGTP IDDVMRVLDIDEFPQSGNYETIGGFMMFMLRKIPKRTDSVKFAGYKFEVVDIDNYRIDQL LVTRIDSKATALSPKLPDAKDKEESVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ytfL |
Synonyms | paeA; ytfL; b4218; JW4177; Polyamine export protein |
UniProt ID | P0AE45 |
◆ Recombinant Proteins | ||
AGPAT5-5985H | Recombinant Human AGPAT5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FARS2-2272R | Recombinant Rat FARS2 Protein | +Inquiry |
HCRT-7522M | Recombinant Mouse HCRT Protein | +Inquiry |
BOK-1065M | Recombinant Mouse BOK Protein, His (Fc)-Avi-tagged | +Inquiry |
COPS6-1890M | Recombinant Mouse COPS6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CG-76H | Active Native Human Chorionic Gonadotropin (CG) | +Inquiry |
GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
TNFRSF11B-54H | Native Human Osteoprotegerin | +Inquiry |
TF-01B | Native Bovine TF Protein | +Inquiry |
OX-LDL-985H | Native Human Lipoproteins, Oxidized LDL protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFYVE27-173HCL | Recombinant Human ZFYVE27 293 Cell Lysate | +Inquiry |
PLGRKT-7928HCL | Recombinant Human C9orf46 293 Cell Lysate | +Inquiry |
TM4SF1-667HCL | Recombinant Human TM4SF1 lysate | +Inquiry |
WNT1-304HCL | Recombinant Human WNT1 293 Cell Lysate | +Inquiry |
GFAP-5955HCL | Recombinant Human GFAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ytfL Products
Required fields are marked with *
My Review for All ytfL Products
Required fields are marked with *
0
Inquiry Basket