Recombinant Full Length Escherichia Coli Uncharacterized Protein Yjfz(Yjfz) Protein, His-Tagged
Cat.No. : | RFL26407EF |
Product Overview : | Recombinant Full Length Escherichia coli Uncharacterized protein yjfZ(yjfZ) Protein (P39308) (1-264aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-264) |
Form : | Lyophilized powder |
AA Sequence : | MTLPTTIYSFPAYLSRFSSTDKPVKLKFHQYARATLLSNRGRDHNCDGRRTVEIHKLDLS DWQAFNKLATRCNAYDGITMNGDNSFGWNHEATLDNIHAQKYNKAYAGARLTAELKYLLQ DVESFEPNSKYTIHEVVLGPGYGTPDYTGQTIGYVVTLPAQMPNCWSSELPTIDLYIDQL RTVTGVSNALGFIIAALLNAYSDLPHDLKIGLRSLSSSAAIYSGLGFERVPQERDISCAR MYLTPANHPDLWTQENGEWIYLRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yjfZ |
Synonyms | yjfZ; b4204; JW4162; Uncharacterized protein YjfZ |
UniProt ID | P39308 |
◆ Recombinant Proteins | ||
Rab39-5315M | Recombinant Mouse Rab39 Protein, Myc/DDK-tagged | +Inquiry |
Bfsp1-705M | Recombinant Mouse Bfsp1 Protein, MYC/DDK-tagged | +Inquiry |
CDKL3-1312R | Recombinant Rat CDKL3 Protein | +Inquiry |
RFL13320SF | Recombinant Full Length Salmonella Paratyphi C Probable Intracellular Septation Protein A(Ycib) Protein, His-Tagged | +Inquiry |
Vtcn1-13M | Recombinant Mouse Vtcn1 | +Inquiry |
◆ Native Proteins | ||
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
CVB6-14 | Native Coxsackievirus B6 Antigen | +Inquiry |
AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
Lectin-1769D | Active Native Dolichos Biflorus Agglutinin Protein, Biotinylated | +Inquiry |
IgY-005C | Native Chicken IgY Ig Fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCGB1C1-2039HCL | Recombinant Human SCGB1C1 293 Cell Lysate | +Inquiry |
Liver-292R | Rhesus monkey Liver Lysate | +Inquiry |
MACROD1-399HCL | Recombinant Human MACROD1 lysate | +Inquiry |
VAX1-421HCL | Recombinant Human VAX1 293 Cell Lysate | +Inquiry |
C2orf69-8065HCL | Recombinant Human C2orf69 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yjfZ Products
Required fields are marked with *
My Review for All yjfZ Products
Required fields are marked with *
0
Inquiry Basket