Recombinant Full Length Escherichia Coli Uncharacterized Membrane Protein Yjcc(Yjcc) Protein, His-Tagged
Cat.No. : | RFL1140EF |
Product Overview : | Recombinant Full Length Escherichia coli Uncharacterized membrane protein YjcC(yjcC) Protein (P32701) (1-528aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-528) |
Form : | Lyophilized powder |
AA Sequence : | MSHRARHQLLALPGIIFLVLFPIILSLWIAFLWAKSEVNNQLRTFAQLALDKSELVIRQA DLVSDAAERYQGQVCTPAHQKRMLNIIRGYLYINELIYARDNHFLCSSLIAPVNGYTIAP ADYKREPNVSIYYYRDTPFFSGYKMTYMQRGNYVAVINPLFWSEVMSDDPTLQWGVYDTV TKTFFSLSKEASAATFSPLIHLKDLTVQRNGYLYATVYSTKRPIAAIVATSYQRLITHFY NHLIFALPAGILGSLVLLLLWLRIRQNYLSPKRKLQRALEKHQLCLYYQPIIDIKTEKCI GAEALLRWPGEQGQIMNPAEFIPLAEKEGMIEQITDYVIDNVFRDLGDYLATHADRYVSI NLSASDFHTSRLIARINQKTEQYAVRPQQIKFEVTEHAFLDVDKMTPIILAFRQAGYEVA IDDFGIGYSNLHNLKSLNVDILKIDKSFVETLTTHKTSHLIAEHIIELAHSLGLKTIAEG VETEEQVNWLRKRGVRYCQGWFFAKAMPPQVFMQWMEQLPARELTRGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pdeC |
Synonyms | pdeC; yjcC; b4061; JW4022; Probable cyclic di-GMP phosphodiesterase PdeC |
UniProt ID | P32701 |
◆ Recombinant Proteins | ||
RFL11815MF | Recombinant Full Length Putative Membrane Protein Mmps1(Mmps1) Protein, His-Tagged | +Inquiry |
SGOL1-8105M | Recombinant Mouse SGOL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL11RA-3155H | Recombinant Human IL11RA protein, His-tagged | +Inquiry |
RUBCN-370HFL | Recombinant Full Length Human RUBCN Protein, C-Flag-tagged | +Inquiry |
VSNL1-447H | Recombinant Human VSNL1 | +Inquiry |
◆ Native Proteins | ||
Copper containing Amine oxidase-004B | Active Native Bovine Copper containing Amine oxidase Protein | +Inquiry |
CALM3-74B | Native Bovine Calmodulin | +Inquiry |
Lectin-1854U | Active Native Ulex Europaeus Agglutinin I Protein | +Inquiry |
C8-57H | Native Human Complement C8 | +Inquiry |
Actin-21R | Native Rabbit Actin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRA2B-827HCL | Recombinant Human TRA2B 293 Cell Lysate | +Inquiry |
ADCYAP1R1-1642HCL | Recombinant Human ADCYAP1R1 cell lysate | +Inquiry |
RUSC1-2105HCL | Recombinant Human RUSC1 293 Cell Lysate | +Inquiry |
NGB-3837HCL | Recombinant Human NGB 293 Cell Lysate | +Inquiry |
MBNL1-AS1-4684HCL | Recombinant Human LOC401093 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All pdeC Products
Required fields are marked with *
My Review for All pdeC Products
Required fields are marked with *
0
Inquiry Basket