Recombinant Full Length Escherichia Coli Trk System Potassium Uptake Protein Trkh(Trkh) Protein, His-Tagged
Cat.No. : | RFL28260EF |
Product Overview : | Recombinant Full Length Escherichia coli Trk system potassium uptake protein trkH(trkH) Protein (P0AFZ7) (1-483aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-483) |
Form : | Lyophilized powder |
AA Sequence : | MHFRAITRIVGLLVILFSGTMIIPGLVALIYRDGAGRAFTQTFFVALAIGSMLWWPNRKE KGELKSREGFLIVVLFWTVLGSVGALPFIFSESPNLTITDAFFESFSGLTTTGATTLVGL DSLPHAILFYRQMLQWFGGMGIIVLAVAILPILGVGGMQLYRAEMPGPLKDNKMRPRIAE TAKTLWLIYVLLTVACALALWFAGMDAFDAIGHSFATIAIGGFSTHDASIGYFDSPTINT IIAIFLLISGCNYGLHFSLLSGRSLKVYWRDPEFRMFIGVQFTLVVICTLVLWFHNVYSS ALMTINQAFFQVVSMATTAGFTTDSIARWPLFLPVLLLCSAFIGGCAGSTGGGLKVIRIL LLFKQGNRELKRLVHPNAVYSIKLGNRALPERILEAVWGFFSAYALVFIVSMLAIIATGV DDFSAFASVVATLNNLGPGLGVVADNFTSMNPVAKWILIANMLFGRLEVFTLLVLFTPTF WRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | trkH |
Synonyms | trkH; b3849; JW5576; Trk system potassium uptake protein TrkH |
UniProt ID | P0AFZ7 |
◆ Recombinant Proteins | ||
SLC6A16B-6194Z | Recombinant Zebrafish SLC6A16B | +Inquiry |
IL21R-1225C | Active Recombinant Cynomolgus/Rhesus IL21R Protein, Fc-tagged | +Inquiry |
CAMSAP1L1-620R | Recombinant Rhesus monkey CAMSAP1L1 Protein, His-tagged | +Inquiry |
ABRA-83R | Recombinant Rat ABRA Protein, His (Fc)-Avi-tagged | +Inquiry |
NLK-3998R | Recombinant Rat NLK Protein | +Inquiry |
◆ Native Proteins | ||
Troponin T-12H | Native Human cardiac Troponin T protein | +Inquiry |
ALB-03C | Native Cynomolgus Monkey ALB protein | +Inquiry |
LDL-246H | Native Human Lipoproteins, Oxidized LDL (OX-LDL) | +Inquiry |
alpha Thrombin native protein-3287H | Native Human alpha Thrombin | +Inquiry |
PLAU-31777TH | Native Human Human SERPINE1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FH-6227HCL | Recombinant Human FH 293 Cell Lysate | +Inquiry |
TGM1-1111HCL | Recombinant Human TGM1 293 Cell Lysate | +Inquiry |
GCNT3-5978HCL | Recombinant Human GCNT3 293 Cell Lysate | +Inquiry |
CENPP-7577HCL | Recombinant Human CENPP 293 Cell Lysate | +Inquiry |
C11orf42-75HCL | Recombinant Human C11orf42 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All trkH Products
Required fields are marked with *
My Review for All trkH Products
Required fields are marked with *
0
Inquiry Basket