Recombinant Full Length Escherichia Coli Transcriptional Activator Cadc(Cadc) Protein, His-Tagged
Cat.No. : | RFL30408EF |
Product Overview : | Recombinant Full Length Escherichia coli Transcriptional activator CadC(cadC) Protein (P23890) (1-512aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-512) |
Form : | Lyophilized powder |
AA Sequence : | MQQPVVRVGEWLVTPSINQISRNGRQLTLEPRLIDLLVFFAQHSGEVLSRDELIDNVWKR SIVTNHVVTQSISELRKSLKDNDEDSPVYIATVPKRGYKLMVPVIWYSEEEGEEIMLSSP PPIPEAVPATDSPSHSLNIQNTATPPEQSPVKSKRFTTFWVWFFFLLSLGICVALVAFSS LDTRLPMSKSRILLNPRDIDINMVNKSCNSWSSPYQLSYAIGVGDLVATSLNTFSTFMVH DKINYNIDEPSSSGKTLSIAFVNQRQYRAQQCFMSIKLVDNADGSTMLDKRYVITNGNQL AIQNDLLESLSKALNQPWPQRMQETLQKILPHRGALLTNFYQAHDYLLHGDDKSLNRASE LLGEIVQSSPEFTYARAEKALVDIVRHSQHPLDEKQLAALNTEIDNIVTLPELNNLSIIY QIKAVSALVKGKTDESYQAINTGIDLEMSWLNYVLLGKVYEMKGMNREAADAYLTAFNLR PGANTLYWIENGIFQTSVPYVVPYLDKFLASE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cadC |
Synonyms | cadC; b4133; JW4094; Transcriptional activator CadC |
UniProt ID | P23890 |
◆ Recombinant Proteins | ||
UNCX-6453R | Recombinant Rat UNCX Protein | +Inquiry |
CA9-890HAF647 | Recombinant Human CA9 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
RFL19443VF | Recombinant Full Length Vitis Vinifera Nad(P)H-Quinone Oxidoreductase Subunit 4L, Chloroplastic(Ndhe) Protein, His-Tagged | +Inquiry |
CITED2-1387H | Recombinant Human CITED2 Protein, GST-tagged | +Inquiry |
SMYD3-8508M | Recombinant Mouse SMYD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CRP-8056H | Native Human C-Reactive Protein | +Inquiry |
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
IgG-351C | Native Cat IgG | +Inquiry |
LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
Collagen-57H | Native Human Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPCAM-001CCL | Recombinant Cynomolgus EPCAM cell lysate | +Inquiry |
IP6K2-5186HCL | Recombinant Human IP6K2 293 Cell Lysate | +Inquiry |
TAB1-1292HCL | Recombinant Human TAB1 293 Cell Lysate | +Inquiry |
CRYBB3-7260HCL | Recombinant Human CRYBB3 293 Cell Lysate | +Inquiry |
APOA1BP-8790HCL | Recombinant Human APOA1BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cadC Products
Required fields are marked with *
My Review for All cadC Products
Required fields are marked with *
0
Inquiry Basket