Recombinant Full Length Escherichia Coli Sensor Protein Zras(Zras) Protein, His-Tagged
Cat.No. : | RFL26978EF |
Product Overview : | Recombinant Full Length Escherichia coli Sensor protein ZraS(zraS) Protein (P14377) (1-465aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-465) |
Form : | Lyophilized powder |
AA Sequence : | MRFMQRSKDSLAKWLSAILPVVIVGLVGLFAVTVIRDYGRASEADRQALLEKGNVLIRAL ESGSRVGMGMRMHHVQQQALLEEMAGQPGVLWFAVTDAQGIIILHSDPDKVGRALYSPDE MQKLKPEENSRWRLLGKTETTPALEVYRLFQPMSAPWRHGMHNMPRCNGKAVPQVDAQQA IFIAVDASDLVATQSGEKRNTLIILFALATVLLASVLSFFWYRRYLRSRQLLQDEMKRKE KLVALGHLAAGVAHEIRNPLSSIKGLAKYFAERAPAGGEAHQLAQVMAKEADRLNRVVSE LLELVKPTHLALQAVDLNTLINHSLQLVSQDANSREIQLRFTANDTLPEIQADPDRLTQV LLNLYLNAIQAIGQHGVISVTASESGAGVKISVTDSGKGIAADQLDAIFTPYFTTKAEGT GLGLAVVHNIVEQHGGTIQVASQEGKGSTFTLWLPVNITRKDPQG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zraS |
Synonyms | zraS; hydH; b4003; JW3967; Sensor protein ZraS |
UniProt ID | P14377 |
◆ Recombinant Proteins | ||
SENP3-2577H | Recombinant Human SENP3, His-tagged | +Inquiry |
PER1-1864H | Recombinant Human PER1 protein, GST-tagged | +Inquiry |
SCO2082-419S | Recombinant Streptomyces coelicolor A3(2) SCO2082 protein, His-tagged | +Inquiry |
Lrpap1-5913M | Recombinant Mouse Lrpap1 protein, His&Myc-tagged | +Inquiry |
SCARB1-467H | Recombinant Human SCARB1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
C1QA-26126TH | Native Human C1QA | +Inquiry |
IgG-012L | Native Llama Ig fraction | +Inquiry |
GlycoProtein G-11H | Native HSV-2 GlycoProtein G | +Inquiry |
HPX-207H | Native Human Hemopexin | +Inquiry |
Ferritin-026H | Native Human Ferritin Protein, holo form | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH1A2-8920HCL | Recombinant Human ALDH1A2 293 Cell Lysate | +Inquiry |
FASTK-6322HCL | Recombinant Human FASTK 293 Cell Lysate | +Inquiry |
Testis-66H | Human Testis Tissue Lysate | +Inquiry |
DHX58-984HCL | Recombinant Human DHX58 cell lysate | +Inquiry |
HSCB-5382HCL | Recombinant Human HSCB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All zraS Products
Required fields are marked with *
My Review for All zraS Products
Required fields are marked with *
0
Inquiry Basket