Recombinant Full Length Escherichia Coli Sensor Protein Qsec(Qsec) Protein, His-Tagged
Cat.No. : | RFL3440EF |
Product Overview : | Recombinant Full Length Escherichia coli Sensor protein qseC(qseC) Protein (P40719) (1-449aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-449) |
Form : | Lyophilized powder |
AA Sequence : | MKFTQRLSLRVRLTLIFLILASVTWLLSSFVAWKQTTDNVDELFDTQLMLFAKRLSTLDL NEINAADRMAQTPNRLKHGHVDDDALTFAIFTHDGRMVLNDGDNGEDIPYSYQREGFADG QLVGEDDPWRFVWMTSPDGKYRIVVGQEWEYREDMALAIVAGQLIPWLVALPIMLIIMMV LLGRELAPLNKLALALRMRDPDSEKPLNATGVPSEVRPLVESLNQLFARTHAMMVRERRF TSDAAHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLHSGIDRATRLVDQLLTLSRLD SLDNLQDVAEIPLEDLLQSSVMDIYHTAQQAKIDVRLTLNAHSIKRTGQPLLLSLLVRNL LDNAVRYSPQGSVVDVTLNADNFIVRDNGPGVTPEALARIGERFYRPPGQTATGSGLGLS IVQRIAKLHGMNVEFGNAEQGGFEAKVSW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | qseC |
Synonyms | qseC; ygiY; b3026; JW2994; Sensor protein QseC |
UniProt ID | P40719 |
◆ Recombinant Proteins | ||
ACHE-208R | Recombinant Rhesus monkey ACHE Protein, His-tagged | +Inquiry |
Myoc-4402M | Recombinant Mouse Myoc protein, His&Myc-tagged | +Inquiry |
MORC3-4600C | Recombinant Chicken MORC3 | +Inquiry |
KIF27-2911R | Recombinant Rat KIF27 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANO1-7513Z | Recombinant Zebrafish ANO1 | +Inquiry |
◆ Native Proteins | ||
IgG-353C | Native Chicken IgG | +Inquiry |
GOT1-5353P | Active Native Porcine GOT1 protein | +Inquiry |
MMP9-39H | Native Human MMP-9/Lipocalin Complex | +Inquiry |
HDL-398H | Native Human High Density Lipoprotein, DiO labeled | +Inquiry |
IgG-004B | Native Bovine Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
IMPAD1-857HCL | Recombinant Human IMPAD1 cell lysate | +Inquiry |
EPS15-6578HCL | Recombinant Human EPS15 293 Cell Lysate | +Inquiry |
MPPED1-4227HCL | Recombinant Human MPPED1 293 Cell Lysate | +Inquiry |
ZNF396-79HCL | Recombinant Human ZNF396 293 Cell Lysate | +Inquiry |
NCOA3-3941HCL | Recombinant Human NCOA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All qseC Products
Required fields are marked with *
My Review for All qseC Products
Required fields are marked with *
0
Inquiry Basket