Recombinant Full Length Escherichia Coli Sensor Protein Phoq(Phoq) Protein, His-Tagged
Cat.No. : | RFL36295EF |
Product Overview : | Recombinant Full Length Escherichia coli Sensor protein PhoQ(phoQ) Protein (P23837) (1-486aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-486) |
Form : | Lyophilized powder |
AA Sequence : | MKKLLRLFFPLSLRVRFLLATAAVVLVLSLAYGMVALIGYSVSFDKTTFRLLRGESNLFY TLAKWENNKLHVELPENIDKQSPTMTLIYDENGQLLWAQRDVPWLMKMIQPDWLKSNGFH EIEADVNDTSLLLSGDHSIQQQLQEVREDDDDAEMTHSVAVNVYPATSRMPKLTIVVVDT IPVELKSSYMVWSWFIYVLSANLLLVIPLLWVAAWWSLRPIEALAKEVRELEEHNRELLN PATTRELTSLVRNLNRLLKSERERYDKYRTTLTDLTHSLKTPLAVLQSTLRSLRSEKMSV SDAEPVMLEQISRISQQIGYYLHRASMRGGTLLSRELHPVAPLLDNLTSALNKVYQRKGV NISLDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDEHLYIVVEDDGPGI PLSKREVIFDRGQRVDTLRPGQGVGLAVAREITEQYEGKIVAGESMLGGARMEVIFGRQH SAPKDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | phoQ |
Synonyms | phoQ; b1129; JW1115; Sensor protein PhoQ; Sensor histidine protein kinase/phosphatase PhoQ |
UniProt ID | P23837 |
◆ Recombinant Proteins | ||
CENPB-3282M | Recombinant Mouse CENPB Protein | +Inquiry |
TUBGCP3-9057HFL | Recombinant Full Length Human TUBGCP3 protein, Flag-tagged | +Inquiry |
MT1E-6988HF | Recombinant Full Length Human MT1E Protein, GST-tagged | +Inquiry |
CYTH1A-12713Z | Recombinant Zebrafish CYTH1A | +Inquiry |
RLN3-4715R | Recombinant Rat RLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
AFP-412H | Native Human AFP Protein | +Inquiry |
C8-57H | Native Human Complement C8 | +Inquiry |
CAPN2-121B | Native Bovine CAPN2 | +Inquiry |
APOA1-8344H | Native Human APOA1 | +Inquiry |
V8Protease-01S | Active Native Staph aureus V8 Protease, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
Testis-499C | Chicken Testis Lysate, Total Protein | +Inquiry |
GPR120-5799HCL | Recombinant Human GPR120 293 Cell Lysate | +Inquiry |
TF-001RCL | Recombinant Rat TF cell lysate | +Inquiry |
GNA15-5871HCL | Recombinant Human GNA15 293 Cell Lysate | +Inquiry |
KRTAP8-1-4839HCL | Recombinant Human KRTAP8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All phoQ Products
Required fields are marked with *
My Review for All phoQ Products
Required fields are marked with *
0
Inquiry Basket