Recombinant Full Length Escherichia Coli Sensor Histidine Kinase Dcus(Dcus) Protein, His-Tagged
Cat.No. : | RFL20720EF |
Product Overview : | Recombinant Full Length Escherichia coli Sensor histidine kinase DcuS(dcuS) Protein (P0AEC8) (1-543aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-543) |
Form : | Lyophilized powder |
AA Sequence : | MRHSLPYRMLRKRPMKLSTTVILMVSAVLFSVLLVVHLIYFSQISDMTRDGLANKALAVA RTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPF KGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQINDSR WSIIWSVLFGMLVGLIGTCILVKVLKKILFGLEPYEISTLFEQRQAMLQSIKEGVVAVDD RGEVTLINDAAQELLNYRKSQDDEKLSTLSHSWSQVVDVSEVLRDGTPRRDEEITIKDRL LLINTVPVRSNGVIIGAISTFRDKTEVRKLMQRLDGLVNYADALRERSHEFMNKLHVILG LLHLKSYKQLEDYILKTANNYQEEIGSLLGKIKSPVIAGFLISKINRATDLGHTLILNSE SQLPDSGSEDQVATLITTLGNLIENALEALGPEPGGEISVTLHYRHGWLHCEVNDDGPGI APDKIDHIFDKGVSTKGSERGVGLALVKQQVENLGGSIAVESEPGIFTQFFVQIPWDGER SNR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dcuS |
Synonyms | dcuS; yjdH; b4125; JW4086; Sensor histidine kinase DcuS; Fumarate sensor |
UniProt ID | P0AEC8 |
◆ Recombinant Proteins | ||
Bub1b-726M | Recombinant Mouse Bub1b Protein, MYC/DDK-tagged | +Inquiry |
CCNT1-3005M | Recombinant Mouse CCNT1 Protein | +Inquiry |
S-456S | Recombinant SARS-CoV-2 (2019-nCoV) Spike RBD(E484K) Protein, His-tagged | +Inquiry |
RFL3343MF | Recombinant Full Length Mouse Taste Receptor Type 2 Member 140(Tas2R140) Protein, His-Tagged | +Inquiry |
SLC30A4-5571C | Recombinant Chicken SLC30A4 | +Inquiry |
◆ Native Proteins | ||
VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
HDLBP-86H | Native Human Lipoproteins | +Inquiry |
Chitosan-004C | Native Crawfish Chitosan Film | +Inquiry |
PRF1-55H | Native Human Perforin | +Inquiry |
CAPN1-27397TH | Active Native Human Calpain-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TINAGL1-1061HCL | Recombinant Human TINAGL1 293 Cell Lysate | +Inquiry |
IAPP-5319HCL | Recombinant Human IAPP 293 Cell Lysate | +Inquiry |
PHACTR3-480HCL | Recombinant Human PHACTR3 lysate | +Inquiry |
Spleen-146R | Rat Spleen Tissue Lysate | +Inquiry |
ETV6-6519HCL | Recombinant Human ETV6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All dcuS Products
Required fields are marked with *
My Review for All dcuS Products
Required fields are marked with *
0
Inquiry Basket