Recombinant Full Length Escherichia Coli Putative Permease Perm(Perm) Protein, His-Tagged
Cat.No. : | RFL334EF |
Product Overview : | Recombinant Full Length Escherichia coli Putative permease perM(perM) Protein (P0AFI9) (1-353aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-353) |
Form : | Lyophilized powder |
AA Sequence : | MLEMLMQWYRRRFSDPEAIALLVILVAGFGIIFFFSGLLAPLLVAIVLAYLLEWPTVRLQ SIGCSRRWATSIVLVVFVGILLLMAFVVLPIAWQQGIYLIRDMPGMLNKLSDFAATLPRR YPALMDAGIIDAMAENMRSRMLTMGDSVVKISLASLVGLLTIAVYLVLVPLMVFFLLKDK EQMLNAVRRVLPRNRGLAGQVWKEMNQQITNYIRGKVLEMIVVGIATWLGFLLFGLNYSL LLAVLVGFSVLIPYIGAFVVTIPVVGVALFQFGAGTEFWSCFAVYLIIQALDGNLLVPVL FSEAVNLHPLVIILSVVIFGGLWGFWGVFFAIPLATLIKAVIHAWPDGQIAQE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | perM |
Synonyms | perM; yfgO; b2493; JW2478; Putative permease PerM |
UniProt ID | P0AFI9 |
◆ Recombinant Proteins | ||
ANPEP-2621P | Recombinant Pig ANPEP Protein (616-963 aa), His-Myc-tagged | +Inquiry |
OLFR492-6370M | Recombinant Mouse OLFR492 Protein, His (Fc)-Avi-tagged | +Inquiry |
REPA-3376S | Recombinant Staphylococcus aureus (strain: K153N, other: ST73-MSSA) REPA protein, His-tagged | +Inquiry |
AURKB-11846Z | Recombinant Zebrafish AURKB | +Inquiry |
Pkib-1941R | Recombinant Rat Pkib Protein, His&GST-tagged | +Inquiry |
◆ Native Proteins | ||
Elastase-01H | Active Native Human Sputum Leucocyte Elastase | +Inquiry |
IgG-166R | Native Rat IgG Fc fragment | +Inquiry |
FTH1-28156TH | Native Human FTH1 | +Inquiry |
IgA-130H | Native Human Immunoglobulin A | +Inquiry |
ALOD-36 | Active Native Alcohol oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC31A1-1736HCL | Recombinant Human SLC31A1 293 Cell Lysate | +Inquiry |
DOLK-6842HCL | Recombinant Human DOLK 293 Cell Lysate | +Inquiry |
TNFRSF14-1133CCL | Recombinant Cynomolgus TNFRSF14 cell lysate | +Inquiry |
CCT6B-7687HCL | Recombinant Human CCT6B 293 Cell Lysate | +Inquiry |
ZNF266-2002HCL | Recombinant Human ZNF266 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All perM Products
Required fields are marked with *
My Review for All perM Products
Required fields are marked with *
0
Inquiry Basket