Recombinant Full Length Escherichia Coli Putative Dna Utilization Protein Hofn(Hofn) Protein, His-Tagged
Cat.No. : | RFL14467EF |
Product Overview : | Recombinant Full Length Escherichia coli Putative DNA utilization protein HofN(hofN) Protein (P64634) (1-179aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-179) |
Form : | Lyophilized powder |
AA Sequence : | MNPPINFLPWRQQRRTAFLRFWLLMFVAPLLLAVGITLILRLTGSAEARIDAVLLQAEQQ LARSLQITKPRLLEQQQLREQRSQRQRQRQFTRDWQSALEALAALLPEHAWLTTISWQQG TLEIKGLTTSITALNALETSLRQDASFHLNQRGATQQDAQGRWQFEYQLTRKVSDEHVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hofN |
Synonyms | hofN; yrfC; b3394; JW3357; DNA utilization protein HofN |
UniProt ID | P64634 |
◆ Native Proteins | ||
CST3-26152TH | Native Human CST3 | +Inquiry |
DD-170H | Active Native Human D-Dimer | +Inquiry |
CFD-348H | Active Native Human Factor D | +Inquiry |
THBD-306R | Active Native Rabbit Lung Thrombomodulin | +Inquiry |
FGB-46P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
Pancreas-660G | Guinea Pig Pancreas Lysate, Total Protein | +Inquiry |
RHEB-001HCL | Recombinant Human RHEB cell lysate | +Inquiry |
RCBTB1-2447HCL | Recombinant Human RCBTB1 293 Cell Lysate | +Inquiry |
C18orf54-8219HCL | Recombinant Human C18orf54 293 Cell Lysate | +Inquiry |
ADRA2C-8999HCL | Recombinant Human ADRA2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hofN Products
Required fields are marked with *
My Review for All hofN Products
Required fields are marked with *
0
Inquiry Basket