Recombinant Full Length Escherichia Coli Pts System Mannitol-Specific Cryptic Eiicb Component(Cmta) Protein, His-Tagged
Cat.No. : | RFL16933EF |
Product Overview : | Recombinant Full Length Escherichia coli PTS system mannitol-specific cryptic EIICB component(cmtA) Protein (P69826) (1-462aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-462) |
Form : | Lyophilized powder |
AA Sequence : | MENKSARAKVQAFGGFLTAMVIPNIGAFIAWGFITALFIPTGWLPNEHFAKIVGPMITYL LPVMIGSTGGHLVGGKRGAVMGGIGTIGVIVGAEIPMFLGSMIMGPLGGLVIKYVDKALE KRIPAGFEMVINNFSLGIAGMLLCLLGFEVIGPAVLIANTFVKECIEALVHAGYLPLLSV INEPAKVLFLNNAIDQGVYYPLGMQQASVNGKSIFFMVASNPGPGLGLLLAFTLFGKGMS KRSAPGAMIIHFLGGIHELYFPYVLMKPLTIIAMIAGGMSGTWMFNLLDGGLVAGPSPGS IFAYLALTPKGSFLATIAGVTVGTLVSFAITSLILKMEKTVETESEDEFAQSANAVKAMK QEGAFSLSRVKRIAFVCDAGMGSSAMGATTFRKRLEKAGLAIEVKHYAIENVPADADIVV THASLEGRVKRVTDKPLILINNYIGDPKLDTLFNQLTAEHKH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cmtA |
Synonyms | cmtA; b2933; JW2900; PTS system mannitol-specific cryptic EIICB component; EIICB-Mtl; EII-Mtl [Includes: Mannitol permease IIC component; PTS system mannitol-specific EIIC component; Mannitol-specific phosphotransferase enzyme IIB component; PTS system ma |
UniProt ID | P69826 |
◆ Recombinant Proteins | ||
Bmper-1057M | Recombinant Mouse Bmper Protein, His (Fc)-Avi-tagged | +Inquiry |
H1F0-2579H | Recombinant Human H1F0 protein(21-120 aa), C-His-tagged | +Inquiry |
BCL7C-2446H | Recombinant human BCL7C, His-tagged | +Inquiry |
FGF13-27598TH | Recombinant Human FGF13 | +Inquiry |
ZWINT-19258M | Recombinant Mouse ZWINT Protein | +Inquiry |
◆ Native Proteins | ||
Apotransferrin-38R | Native Rat Apotransferrin | +Inquiry |
Cp-048R | Native Rat Ceruloplasmin | +Inquiry |
RWV-307S | Native Snake RVV-V ACTIVATOR | +Inquiry |
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM206A-7927HCL | Recombinant Human C9orf6 293 Cell Lysate | +Inquiry |
NEU4-3869HCL | Recombinant Human NEU4 293 Cell Lysate | +Inquiry |
RPAP3-2237HCL | Recombinant Human RPAP3 293 Cell Lysate | +Inquiry |
PRF1-2873HCL | Recombinant Human PRF1 293 Cell Lysate | +Inquiry |
DNM1L-6858HCL | Recombinant Human DNM1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cmtA Products
Required fields are marked with *
My Review for All cmtA Products
Required fields are marked with *
0
Inquiry Basket