Recombinant Full Length Escherichia Coli Protoheme Ix Farnesyltransferase(Cyoe) Protein, His-Tagged
Cat.No. : | RFL23335EF |
Product Overview : | Recombinant Full Length Escherichia coli Protoheme IX farnesyltransferase(cyoE) Protein (B1J021) (1-296aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-296) |
Form : | Lyophilized powder |
AA Sequence : | MMFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVGVSLVVASGCVFNNYI DRDIDRKMERTKNRVLVKGLISPAVSLVYATLLGIAGFMLLWFGANPLACWLGVMGFVVY VGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGEFDSGAAILLAIFSLWQMPHSYAI AIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLMLSLGGYAGYKYLVVAAAV SVWWLGMALRGYKVADDRIWARKLFGFSIIAITALSVMMSVDFMVPDSHTLLAAVW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cyoE |
Synonyms | cyoE; EcolC_3205; Protoheme IX farnesyltransferase; Heme B farnesyltransferase; Heme O synthase |
UniProt ID | B1J021 |
◆ Native Proteins | ||
OAC-34 | Active Native Oxaloacetate decarboxylase | +Inquiry |
GC-29857TH | Native Human GC | +Inquiry |
ACOD-35 | Active Native acyl-CoA oxidase | +Inquiry |
LDL-393H | Native Human Low Density Lipoprotein | +Inquiry |
IgG1-228H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALM3-7888HCL | Recombinant Human CALM3 293 Cell Lysate | +Inquiry |
ORAI3-459HCL | Recombinant Human ORAI3 lysate | +Inquiry |
FRAT2-666HCL | Recombinant Human FRAT2 cell lysate | +Inquiry |
CHGA-7540HCL | Recombinant Human CHGA 293 Cell Lysate | +Inquiry |
THBS1-1101HCL | Recombinant Human THBS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cyoE Products
Required fields are marked with *
My Review for All cyoE Products
Required fields are marked with *
0
Inquiry Basket