Recombinant Full Length Escherichia Coli Phosphatidylglycerophosphatase A(Pgpa) Protein, His-Tagged
Cat.No. : | RFL18401EF |
Product Overview : | Recombinant Full Length Escherichia coli Phosphatidylglycerophosphatase A(pgpA) Protein (P18200) (1-172aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-172) |
Form : | Lyophilized powder |
AA Sequence : | MTILPRHKDVAKSRLKMSNPWHLLAVGFGSGLSPIVPGTMGSLAAIPFWYLMTFLPWQLY SLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMALPTNDWQWVAAGFVIF RILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIGHHWPLGILS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pgpA |
Synonyms | pgpA; yajN; b0418; JW0408; Phosphatidylglycerophosphatase A; Phosphatidylglycerolphosphate phosphatase A; PGP phosphatase A |
UniProt ID | P18200 |
◆ Native Proteins | ||
Lectin-1833R | Active Native Ricinus Communis Agglutinin I Protein | +Inquiry |
F9-671H | Native Human Coagulation Factor IX | +Inquiry |
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
THBD-306R | Active Native Rabbit Lung Thrombomodulin | +Inquiry |
LCN2-384H | Native Human LCN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MERTK-484HCL | Recombinant Human MERTK cell lysate | +Inquiry |
ENTPD8-558HCL | Recombinant Human ENTPD8 cell lysate | +Inquiry |
KPTN-4886HCL | Recombinant Human KPTN 293 Cell Lysate | +Inquiry |
Medulla Oblongata-339R | Rhesus monkey Medulla Oblongata Lysate | +Inquiry |
RNF24-2280HCL | Recombinant Human RNF24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All pgpA Products
Required fields are marked with *
My Review for All pgpA Products
Required fields are marked with *
0
Inquiry Basket