Recombinant Full Length Escherichia Coli Osmolarity Sensor Protein Envz(Envz) Protein, His-Tagged
Cat.No. : | RFL6411EF |
Product Overview : | Recombinant Full Length Escherichia coli Osmolarity sensor protein EnvZ(envZ) Protein (P0AEJ4) (1-450aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-450) |
Form : | Lyophilized powder |
AA Sequence : | MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML ELGTSERGGLSIRAWLPVPVTRAQGTTKEG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | envZ |
Synonyms | envZ; ompB; perA; tpo; b3404; JW3367; Sensor histidine kinase EnvZ; Osmolarity sensor protein EnvZ |
UniProt ID | P0AEJ4 |
◆ Recombinant Proteins | ||
HYAL2-301635H | Recombinant Human ZHYAL2 protein, GST-tagged | +Inquiry |
HR-7841M | Recombinant Mouse HR Protein | +Inquiry |
TNFSF13B-138T | Active Recombinant Human TNFSF13B Protein (153 aa) | +Inquiry |
IKBKB-421HFL | Active Recombinant Full Length Human IKBKB Protein, C-Flag-tagged | +Inquiry |
UBE3C-17740M | Recombinant Mouse UBE3C Protein | +Inquiry |
◆ Native Proteins | ||
KLK3-385H | Native Human Prostate Specific Antigen (PSA), High pI Isoform (IEF) | +Inquiry |
ppk-8320P | Native Propionibacterium shermanii ppk | +Inquiry |
Ferritin-025B | Native Bovine Ferritin Protein, apo-form | +Inquiry |
Lectin-1776G | Active Native Galanthus Nivalis Lectin Protein, Agarose bound | +Inquiry |
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NHEJ1-3834HCL | Recombinant Human NHEJ1 293 Cell Lysate | +Inquiry |
C11orf1-8356HCL | Recombinant Human C11orf1 293 Cell Lysate | +Inquiry |
PPP1R14A-2945HCL | Recombinant Human PPP1R14A 293 Cell Lysate | +Inquiry |
PSG6-406HCL | Recombinant Human PSG6 cell lysate | +Inquiry |
GATSL3-6004HCL | Recombinant Human GATSL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All envZ Products
Required fields are marked with *
My Review for All envZ Products
Required fields are marked with *
0
Inquiry Basket