Recombinant Full Length Escherichia Coli O9:H4 Upf0756 Membrane Protein Yeal(Yeal) Protein, His-Tagged
Cat.No. : | RFL7741EF |
Product Overview : | Recombinant Full Length Escherichia coli O9:H4 UPF0756 membrane protein YeaL(yeaL) Protein (A8A0Y2) (1-148aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-148) |
Form : | Lyophilized powder |
AA Sequence : | MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPLSTFFPWIEKQGLSIGIIILTI GVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQPQLVAGLLVGT VLGVALFRGVPVGPLIAAGLVSLIVGKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yeaL |
Synonyms | yeaL; EcHS_A1875; UPF0756 membrane protein YeaL |
UniProt ID | A8A0Y2 |
◆ Recombinant Proteins | ||
ANKS6-1462Z | Recombinant Zebrafish ANKS6 | +Inquiry |
MAPKAPK3-1055H | Recombinant Human Mitogen-activated Protein Kinase-Activated Protein Kinase 3, GST-tagged | +Inquiry |
GOLM1-6943H | Recombinant Human GOLM1, His tagged | +Inquiry |
KCND3-2832R | Recombinant Rat KCND3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CMTM8-4462C | Recombinant Chicken CMTM8 | +Inquiry |
◆ Native Proteins | ||
CKM-5306H | Native Human creatine kinase, muscle | +Inquiry |
Lectin-1848S | Active Native Soybean Agglutinin Protein | +Inquiry |
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
PIV3-20 | Native Parainfluenza Virus Type 3 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBB2B-650HCL | Recombinant Human TUBB2B 293 Cell Lysate | +Inquiry |
C17orf75-8231HCL | Recombinant Human C17orf75 293 Cell Lysate | +Inquiry |
VAPA-431HCL | Recombinant Human VAPA 293 Cell Lysate | +Inquiry |
PARP11-3429HCL | Recombinant Human PARP11 293 Cell Lysate | +Inquiry |
PRAF2-2899HCL | Recombinant Human PRAF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yeaL Products
Required fields are marked with *
My Review for All yeaL Products
Required fields are marked with *
0
Inquiry Basket