Recombinant Full Length Escherichia Coli O9:H4 Rhomboid Protease Glpg(Glpg) Protein, His-Tagged
Cat.No. : | RFL17302EF |
Product Overview : | Recombinant Full Length Escherichia coli O9:H4 Rhomboid protease glpG(glpG) Protein (A8A5N2) (1-276aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-276) |
Form : | Lyophilized powder |
AA Sequence : | MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | glpG |
Synonyms | glpG; EcHS_A3621; Rhomboid protease GlpG; Intramembrane serine protease |
UniProt ID | A8A5N2 |
◆ Recombinant Proteins | ||
MTR-3476R | Recombinant Rat MTR Protein, His (Fc)-Avi-tagged | +Inquiry |
E5B-01H | Recombinant HPV-11 E5B Protein | +Inquiry |
OPCML-294H | Recombinant Human OPCML Protein, MYC/DDK-tagged | +Inquiry |
HBG2-16H | Recombinant Human HBG2 protein, His-tagged | +Inquiry |
HMOX1-277H | Recombinant Human HMOX1 protein, His/MBP-tagged | +Inquiry |
◆ Native Proteins | ||
Laminin-01H | Native Human Laminin Protein | +Inquiry |
Fixa-278B | Active Native Bovine Factor Ixa | +Inquiry |
Plg-1897R | Native Rat Plasminogen | +Inquiry |
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEPT4-1959HCL | Recombinant Human SEPT4 293 Cell Lysate | +Inquiry |
CCIN-7738HCL | Recombinant Human CCIN 293 Cell Lysate | +Inquiry |
C17orf82-8226HCL | Recombinant Human C17orf82 293 Cell Lysate | +Inquiry |
FAM196A-6391HCL | Recombinant Human FAM196A 293 Cell Lysate | +Inquiry |
TWF2-632HCL | Recombinant Human TWF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All glpG Products
Required fields are marked with *
My Review for All glpG Products
Required fields are marked with *
0
Inquiry Basket