Recombinant Full Length Escherichia Coli O6:K15:H31 Protein Aaex(Aaex) Protein, His-Tagged
Cat.No. : | RFL28802EF |
Product Overview : | Recombinant Full Length Escherichia coli O6:K15:H31 Protein AaeX(aaeX) Protein (Q0TCM3) (1-67aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-67) |
Form : | Lyophilized powder |
AA Sequence : | MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aaeX |
Synonyms | aaeX; ECP_3326; Protein AaeX |
UniProt ID | Q0TCM3 |
◆ Recombinant Proteins | ||
SNAP25-8515M | Recombinant Mouse SNAP25 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cd86-2282MAF488 | Recombinant Mouse Cd86 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
DGAT2-4536M | Recombinant Mouse DGAT2 Protein | +Inquiry |
SCO4928-516S | Recombinant Streptomyces coelicolor A3(2) SCO4928 protein, His-tagged | +Inquiry |
TMEM81-6179R | Recombinant Rat TMEM81 Protein | +Inquiry |
◆ Native Proteins | ||
pepsin -174P | Native Pig pepsin(1:3000) active | +Inquiry |
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
Luciferase-10V | Native Vibrio fischeri Luciferase | +Inquiry |
Collagen Type Ⅱ-525B | Native Bovine Type Collagen Type Ⅱ Protein | +Inquiry |
MOMP-02C | Native C. trachomatis MOMP Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Lung-108M | Mouse Lung Tissue Lysate (0 Days Old) | +Inquiry |
LAMA4-967HCL | Recombinant Human LAMA4 cell lysate | +Inquiry |
FOPNL-8248HCL | Recombinant Human C16orf63 293 Cell Lysate | +Inquiry |
FNTB-6170HCL | Recombinant Human FNTB 293 Cell Lysate | +Inquiry |
LGTN-4755HCL | Recombinant Human LGTN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aaeX Products
Required fields are marked with *
My Review for All aaeX Products
Required fields are marked with *
0
Inquiry Basket