Recombinant Full Length Escherichia Coli O45:K1 Spermidine Export Protein Mdti(Mdti) Protein, His-Tagged
Cat.No. : | RFL11663EF |
Product Overview : | Recombinant Full Length Escherichia coli O45:K1 Spermidine export protein MdtI(mdtI) Protein (B7M9V2) (1-109aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-109) |
Form : | Lyophilized powder |
AA Sequence : | MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mdtI |
Synonyms | mdtI; ECS88_1644; Spermidine export protein MdtI |
UniProt ID | B7M9V2 |
◆ Native Proteins | ||
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
Stomach-004H | Human Stomach Lysate, Total Protein | +Inquiry |
ACTN3-3280C | Native Chicken ACTN3 | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK1-743MCL | Recombinant Mouse KLK1 cell lysate | +Inquiry |
SDCBP-2015HCL | Recombinant Human SDCBP 293 Cell Lysate | +Inquiry |
KLK11-1551MCL | Recombinant Mouse KLK11 cell lysate | +Inquiry |
MIB1-4324HCL | Recombinant Human MIB1 293 Cell Lysate | +Inquiry |
ALDH9A1-61HCL | Recombinant Human ALDH9A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mdtI Products
Required fields are marked with *
My Review for All mdtI Products
Required fields are marked with *
0
Inquiry Basket