Recombinant Full Length Escherichia Coli O45:K1 Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL9765EF |
Product Overview : | Recombinant Full Length Escherichia coli O45:K1 Membrane protein insertase YidC(yidC) Protein (B7MGC7) (1-548aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-548) |
Form : | Lyophilized powder |
AA Sequence : | MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNV QNAGEKPLEISTFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; ECS88_4129; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | B7MGC7 |
◆ Recombinant Proteins | ||
HEXIM1-2490R | Recombinant Rat HEXIM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAPSS2-3117R | Recombinant Rhesus Macaque PAPSS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MX1-321HF | Recombinant Full Length Human MX1 Protein | +Inquiry |
Cd4-224M | Recombinant Mouse CD4 antigen Protein, Tag Free | +Inquiry |
MSH4-5651H | Recombinant Human MSH4 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CPB2-27270TH | Native Human CPB2 | +Inquiry |
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
Prothrombin-93H | Native Human Prothrombin | +Inquiry |
ACTA1-853R | Native Rabbit ACTA1 Protein | +Inquiry |
IgG1-226H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR2DL4-002HCL | Recombinant Human KIR2DL4 cell lysate | +Inquiry |
KCNK7-5029HCL | Recombinant Human KCNK7 293 Cell Lysate | +Inquiry |
SAMD12-2073HCL | Recombinant Human SAMD12 293 Cell Lysate | +Inquiry |
SEC13-2000HCL | Recombinant Human SEC13 293 Cell Lysate | +Inquiry |
SF3B14-1918HCL | Recombinant Human SF3B14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket