Recombinant Full Length Escherichia Coli O45:K1 Electron Transport Complex Protein Rnfa(Rnfa) Protein, His-Tagged
Cat.No. : | RFL9742EF |
Product Overview : | Recombinant Full Length Escherichia coli O45:K1 Electron transport complex protein RnfA(rnfA) Protein (B7M9Y1) (1-193aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-193) |
Form : | Lyophilized powder |
AA Sequence : | MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTMAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rsxA |
Synonyms | rsxA; ECS88_1675; Ion-translocating oxidoreductase complex subunit A; Rsx electron transport complex subunit A |
UniProt ID | B7M9Y1 |
◆ Recombinant Proteins | ||
HEATR2-4669H | Recombinant Human HEATR2 Protein, GST-tagged | +Inquiry |
RFPL4A-1049H | Recombinant Human RFPL4A Protein, MYC/DDK-tagged | +Inquiry |
RPN2-14455M | Recombinant Mouse RPN2 Protein | +Inquiry |
SUSD1-3079H | Recombinant Human SUSD1 Protein, MYC/DDK-tagged | +Inquiry |
TCF3-32H | Recombinant Human TCF3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
AFP-3018P | Native pig AFP | +Inquiry |
LDH5-24H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
CGB-359H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
GPX1-8429H | Native Human GPX1 | +Inquiry |
RNASE1-392C | Native Cattle RNASE1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDA-MB-231-003WCY | Human Breast Adenocarcinoma MDA-MB-231 Whole Cell Lysate | +Inquiry |
PTRHD1-112HCL | Recombinant Human PTRHD1 lysate | +Inquiry |
KLK1-743MCL | Recombinant Mouse KLK1 cell lysate | +Inquiry |
COL2A1-2063HCL | Recombinant Human COL2A1 cell lysate | +Inquiry |
MGLL-4330HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All rsxA Products
Required fields are marked with *
My Review for All rsxA Products
Required fields are marked with *
0
Inquiry Basket