Recombinant Full Length Escherichia Coli O157:H7 Upf0756 Membrane Protein Yeal(Yeal) Protein, His-Tagged
Cat.No. : | RFL16469EF |
Product Overview : | Recombinant Full Length Escherichia coli O157:H7 UPF0756 membrane protein YeaL(yeaL) Protein (C6UX49) (1-148aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-148) |
Form : | Lyophilized powder |
AA Sequence : | MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPLSTFFPWIEKQGLSIGIIILTI GVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQPQLVAGLLVGT VLGVALFRGVPVGPLIATGLVSLIVGKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yeaL |
Synonyms | yeaL; ECSP_2361; UPF0756 membrane protein YeaL |
UniProt ID | C6UX49 |
◆ Recombinant Proteins | ||
ACTR5-1257M | Recombinant Mouse ACTR5 Protein | +Inquiry |
CD226-2190HAF647 | Recombinant Human CD226 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
GTF2B-30662TH | Recombinant Human GTF2B | +Inquiry |
UBE2E2-0025H | Recombinant Human UBE2E2 Protein (S2-T201), Tag Free | +Inquiry |
CDC42EP3-1489M | Recombinant Mouse CDC42EP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-45R | Native Rat Collagen I | +Inquiry |
FSME-07 | Native FSME (TBE) Virus Antigen | +Inquiry |
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
FSH-93P | Active Native Porcine FSH | +Inquiry |
IgG-117P | Native Porcine Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERBB2-2010RCL | Recombinant Rat ERBB2 cell lysate | +Inquiry |
ADRBK2-13HCL | Recombinant Human ADRBK2 lysate | +Inquiry |
BST1-2801HCL | Recombinant Human BST1 cell lysate | +Inquiry |
CNIH2-7409HCL | Recombinant Human CNIH2 293 Cell Lysate | +Inquiry |
Optic Nerve-38H | Human Optic Nerve Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yeaL Products
Required fields are marked with *
My Review for All yeaL Products
Required fields are marked with *
0
Inquiry Basket