Recombinant Full Length Escherichia Coli O127:H6 Upf0410 Protein Ymge(Ymge) Protein, His-Tagged
Cat.No. : | RFL35344EF |
Product Overview : | Recombinant Full Length Escherichia coli O127:H6 UPF0410 protein ymge(ymgE) Protein (P58767) (1-84aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-84) |
Form : | Lyophilized powder |
AA Sequence : | MGIIAWIIFGLIAGIIAKLIMPGRDGGGFFLTCILGIVGAVVGGWLATMFGIGGSISGFN LHSFLVAVVGAILVLGVFRLLQRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ymgE |
Synonyms | ymgE; tag; E2348C_1314; UPF0410 protein YmgE; Transglycosylase-associated gene protein |
UniProt ID | P58767 |
◆ Recombinant Proteins | ||
CRISP3-1679H | Recombinant Human CRISP3 Protein (Asn21-Ser243), N-His tagged | +Inquiry |
CD46-6463H | Recombinant Human CD46 protein, GST-tagged | +Inquiry |
ATG7-845R | Recombinant Rat ATG7 Protein | +Inquiry |
CAPN2-453R | Recombinant Rhesus Macaque CAPN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lif-1317M | Recombinant Mouse Lif Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CTSL1-1859H | Native Human Cathepsin L1 | +Inquiry |
MB-236B | Native Bovine Myoglobin | +Inquiry |
Cpn-33 | Native Premium Chlamydia pneumoniae Antigen | +Inquiry |
IgG-05T | Native Toxoplasma gondii IgG antigen, RH strain | +Inquiry |
Lectin-1826P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C14orf169-206HCL | Recombinant Human C14orf169 cell lysate | +Inquiry |
CLDN17-7467HCL | Recombinant Human CLDN17 293 Cell Lysate | +Inquiry |
TBXAS1-1196HCL | Recombinant Human TBXAS1 293 Cell Lysate | +Inquiry |
CRYAA-7267HCL | Recombinant Human CRYAA 293 Cell Lysate | +Inquiry |
ACTR3B-9048HCL | Recombinant Human ACTR3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ymgE Products
Required fields are marked with *
My Review for All ymgE Products
Required fields are marked with *
0
Inquiry Basket