Recombinant Full Length Escherichia Coli Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL8644EF |
Product Overview : | Recombinant Full Length Escherichia coli Membrane protein insertase YidC(yidC) Protein (B1IX33) (1-548aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-548) |
Form : | Lyophilized powder |
AA Sequence : | MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNV QNAGEKPLEISTFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; EcolC_4289; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | B1IX33 |
◆ Recombinant Proteins | ||
RTN4A-7933Z | Recombinant Zebrafish RTN4A | +Inquiry |
ELAVL3-2732M | Recombinant Mouse ELAVL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
YMFJ-3619B | Recombinant Bacillus subtilis YMFJ protein, His-tagged | +Inquiry |
GOLM1-4824H | Recombinant Human GOLM1 Protein (Val40-Leu401), C-His tagged | +Inquiry |
CES5A-5238H | Recombinant Human CES5A Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-10G | Native Goat Collagen Type I Protein | +Inquiry |
C6-55H | Native Human Complement C6 | +Inquiry |
COL2A1-14B | Native Bovine COL2A1 Protein | +Inquiry |
FGB-59R | Native Rabbit Fibrinogen | +Inquiry |
CALMODULIN-185B | Active Native Bovine Calmodulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CACNB1-7903HCL | Recombinant Human CACNB1 293 Cell Lysate | +Inquiry |
FAM171B-783HCL | Recombinant Human FAM171B cell lysate | +Inquiry |
RARG-2512HCL | Recombinant Human RARG 293 Cell Lysate | +Inquiry |
CRELD1-1250HCL | Recombinant Human CRELD1 cell lysate | +Inquiry |
FAIM3-753HCL | Recombinant Human FAIM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket