Recombinant Full Length Escherichia Coli Inner Membrane Protein Yibh(Yibh) Protein, His-Tagged
Cat.No. : | RFL4733EF |
Product Overview : | Recombinant Full Length Escherichia coli Inner membrane protein yibH(yibH) Protein (P0AFV0) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MDLLIVLTYVALAWAVFKIFRIPVNQWTLATAALGGVFLVSGLILLMNYNHPYTFTAQKA VIAIPITPQVTGIVTEVTDKNNQLIQKGEVLFKLDPVRYQARVDRLQADLMTATHNIKTL RAQLTEAQANTTQVSAERDRLFKNYQRYLKGSQAAVNPFSERDIDDARQNFLAQDALVKG SVAEQAQIQSQLDSMVNGEQSQIVSLRAQLTEAKYNLEQTVIRAPSNGYVTQVLIRPGTY AAALPLRPVMVFIPEQKRQIVAQFRQNSLLRLKPGDDAEVVFNALPGQVFHGKLTSILPV VPGGSYQAQGVLQSLTVVPGTDGVLGTIELDPNDDIDALPDGIYAQVAVYSDHFSHVSVM RKVLLRMTSWMHYLYLDH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yibH |
Synonyms | yibH; b3597; JW3571; Inner membrane protein YibH |
UniProt ID | P0AFV0 |
◆ Recombinant Proteins | ||
IL6ST-353M | Recombinant Mouse IL6ST protein, Fc-tagged | +Inquiry |
IL22-5005H | Recombinant Human IL22 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
YLME-3537B | Recombinant Bacillus subtilis YLME protein, His-tagged | +Inquiry |
Dapp1-2454M | Recombinant Mouse Dapp1 Protein, Myc/DDK-tagged | +Inquiry |
ACAT2-9277H | Recombinant Human ACAT2 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Immunoglobulin-5264B | Native Bovine Immunoglobulin Protein | +Inquiry |
IgG-019R | Native Rat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
PTGS1-58S | Native Sheep PTGS1 Protein | +Inquiry |
PGN-17S | Native S. aureus PGN Protein | +Inquiry |
IgM-04T | Native Toxoplasma gondii IgM antigen, RH strain | +Inquiry |
◆ Cell & Tissue Lysates | ||
GEMIN8-5958HCL | Recombinant Human GEMIN8 293 Cell Lysate | +Inquiry |
INMT-347HCL | Recombinant Human INMT lysate | +Inquiry |
FCGRT-6278HCL | Recombinant Human FCGRT 293 Cell Lysate | +Inquiry |
CLEC4A2-1203RCL | Recombinant Rat CLEC4A2 cell lysate | +Inquiry |
Liver-279H | Human Liver (LT Lobe) Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yibH Products
Required fields are marked with *
My Review for All yibH Products
Required fields are marked with *
0
Inquiry Basket