Recombinant Full Length Escherichia Coli Colicin-N(Cna) Protein, His-Tagged
Cat.No. : | RFL14427EF |
Product Overview : | Recombinant Full Length Escherichia coli Colicin-N(cna) Protein (P08083) (1-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-387) |
Form : | Lyophilized powder |
AA Sequence : | MGSNGADNAHNNAFGGGKNPGIGNTSGAGSNGSASSNRGNSNGWSWSNKPHKNDGFHSDG SYHITFHGDNNSKPKPGGNSGNRGNNGDGASAKVGEITITPDNSKPGRYISSNPEYSLLA KLIDAESIKGTEVYTFHTRKGQYVKVTVPDSNIDKMRVDYVNWKGPKYNNKLVKRFVSQF LLFRKEEKEKNEKEALLKASELVSGMGDKLGEYLGVKYKNVAKEVANDIKNFHGRNIRSY NEAMASLNKVLANPKMKVNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEK IREKSIEGYNTGNWGPLLLEVESWIIGGVVAGVAISLFGAVLSFLPISGLAVTALGVIGI MTISYLSSFIDANRVSNINNIISSVIR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cna |
Synonyms | cna; Colicin-N |
UniProt ID | P08083 |
◆ Recombinant Proteins | ||
SE0550-4482S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0550 protein, His-tagged | +Inquiry |
STAT2-8474H | Recombinant Human STAT2, His-tagged | +Inquiry |
SH-RS09675-5455S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS09675 protein, His-tagged | +Inquiry |
RAB2A-4544R | Recombinant Rat RAB2A Protein, His (Fc)-Avi-tagged | +Inquiry |
NR1I2-3724R | Recombinant Rat NR1I2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GG-187B | Native Bovine Gamma Globulin protein | +Inquiry |
ACE-3047R | Native rabbit ACE | +Inquiry |
F13A1-28806TH | Native Human F13A1 | +Inquiry |
LYZ-139C | Native Chicken lysozyme | +Inquiry |
Collagen-315B | Native Bovine Collagen Type III | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIP-3176HCL | Recombinant Human PIP 293 Cell Lysate | +Inquiry |
CCT7-313HCL | Recombinant Human CCT7 cell lysate | +Inquiry |
MAB21L2-4572HCL | Recombinant Human MAB21L2 293 Cell Lysate | +Inquiry |
Hippocampus-238C | Cynomolgus monkey Hippocampus Lysate | +Inquiry |
GM2A-450HCL | Recombinant Human GM2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cna Products
Required fields are marked with *
My Review for All cna Products
Required fields are marked with *
0
Inquiry Basket