Recombinant Full Length Escherichia Coli Bactoprenol Glucosyl Transferase Homolog From Prophage Cps-53(Yfdh) Protein, His-Tagged
Cat.No. : | RFL23881EF |
Product Overview : | Recombinant Full Length Escherichia coli Bactoprenol glucosyl transferase homolog from prophage CPS-53(yfdH) Protein (P77293) (1-306aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-306) |
Form : | Lyophilized powder |
AA Sequence : | MKISLVVPVFNEEEAIPIFYKTVREFEELKSYEVEIVFINDGSKDATESIINALAVSDPL VVPLSFTRNFGKEPALFAGLDHATGDAIIPIDVDLQDPIEVIPHLIEKWQAGADMVLAKR SDRSTDGRLKRKTAEWFYKLHNKISNPKIEENVGDFRLMSRDVVENIKLMPERNLFMKGI LSWVGGKTDIVEYVRAERIAGDTKFNGWKLWNLALEGITSFSTFPLRIWTYIGLVVASVA FIYGAWMILDTIIFGNAVRGYPSLLVSILFLGGIQMIGIGVLGEYIGRTYIETKKRPKYI IKRVKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yfdH |
Synonyms | yfdH; b2351; JW2347; Prophage bactoprenol glucosyl transferase homolog; Bactoprenol glucosyl transferase homolog from prophage CPS-53 |
UniProt ID | P77293 |
◆ Native Proteins | ||
CNTF-26839TH | Native Human CNTF | +Inquiry |
C.Pneumoniae-32 | Native Chlamydia pneumoniae Antigen | +Inquiry |
S100a6-43M | Native Mouse S100A6 | +Inquiry |
Lectin-1812P | Active Native Peanut Lectin Protein, Agarose Bound | +Inquiry |
LALBA-8173H | Native Human Lactalbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD16-22HCL | Recombinant Human ANKRD16 lysate | +Inquiry |
HPDL-5403HCL | Recombinant Human HPDL 293 Cell Lysate | +Inquiry |
CD300LB-176HCL | Recombinant Human CD300LB lysate | +Inquiry |
TNFRSF12A-1560HCL | Recombinant Human TNFRSF12A cell lysate | +Inquiry |
KIFC2-933HCL | Recombinant Human KIFC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yfdH Products
Required fields are marked with *
My Review for All yfdH Products
Required fields are marked with *
0
Inquiry Basket