Recombinant Full Length Erwinia Carotovora Subsp. Atroseptica Cdp-Diacylglycerol--Glycerol-3-Phosphate 3-Phosphatidyltransferase(Pgsa) Protein, His-Tagged
Cat.No. : | RFL35890PF |
Product Overview : | Recombinant Full Length Erwinia carotovora subsp. atroseptica CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase(pgsA) Protein (Q6D364) (2-182aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pectobacterium atrosepticum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-182) |
Form : | Lyophilized powder |
AA Sequence : | QFNIPTLLTLFRVALIPFFVLAFYLPFVWAPLLCALIFVFAAVTDWFDGFLARRWKQTTR FGAFLDPVADKVMVAVALVLVAEYYHSWWITLPAATMIAREIIISALREWMAEIGKRSSV AVSWIGKVKTTAQMMALFALLWRPERIVEGIGVAALYIAAVLTFWSMFQYLNAARHDLLE P |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pgsA |
Synonyms | pgsA; ECA2880; CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase; Phosphatidylglycerophosphate synthase; PGP synthase |
UniProt ID | Q6D364 |
◆ Native Proteins | ||
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
Collagen-325H | Native Human Collagen Type I | +Inquiry |
Acetate Kinase-22B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
Lectin-1769D | Active Native Dolichos Biflorus Agglutinin Protein, Biotinylated | +Inquiry |
GC-524H | Native Human GC protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTC32-679HCL | Recombinant Human TTC32 293 Cell Lysate | +Inquiry |
VOPP1-399HCL | Recombinant Human VOPP1 293 Cell Lysate | +Inquiry |
PECAM1-3049HCL | Recombinant Human PECAM1 cell lysate | +Inquiry |
ZFAND1-1972HCL | Recombinant Human ZFAND1 cell lysate | +Inquiry |
IL36B-5236HCL | Recombinant Human IL1F8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pgsA Products
Required fields are marked with *
My Review for All pgsA Products
Required fields are marked with *
0
Inquiry Basket