Recombinant Full Length Erwinia Amylovora Putative Tyrosine-Protein Kinase Amsa(Amsa) Protein, His-Tagged
Cat.No. : | RFL31739EF |
Product Overview : | Recombinant Full Length Erwinia amylovora Putative tyrosine-protein kinase AmsA(amsA) Protein (Q46631) (1-726aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Erwinia Amylovora |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-726) |
Form : | Lyophilized powder |
AA Sequence : | MKSKIEEPSANGGEAIRFELAHLLGQLLDHRWMIVAVSVLFTLMGTLYSLFATPIYSADA MVQVEQKNANTVLNDISQMMPNAQPASAAEIEIITSRMVLGKTVADLGLDVLVQQDHFPL IGAGLSRIIGQKAQQIAVSRLKVPTLWDKRELSVEVDGPDSYTVSKDGNELFKGKVGQFE QHGDVTMLVNSIEADAGTRFTVSKLNNLQAIKMISNNLVVADMGKDTGVLGLTYSGEDPV QISRVLDQVINNYLYQNIARKSEEAEKSIQFLAQQLPDVRAKLDQAEDKLNVFRRKHDSV DMSLEAKSALDSSVSIQTQLNALTFREAEVSQLFKKDHPTYRALLEKRQTLDEQQKQLNG KISQMPQTQQEIVRLTRDVQAGQEIYMQLLNRQQELNISKASTVGDVRIIDHAETAAKPV APKSILIVAGSLILGLVVSVGLVLMKALFHHGIDNPEQLEELGLNVYASVPLSEWQRKKD QETLLKRKLDARTDPHNRLLALGNPTDLSIEAIRSLRTSLHFAMMDAQNNILMITGASPG IGKTFVCANLATLVAKTGEKVLFIDGDMRRGYTHELLGAESKTGLSDILSGKLPFNTDLV QRGDYGFDFIARGQVPPNPSELLMNSRMKELVHWASQNYDLVLIDTPPILAVTDASIIGK LAGTSLMVARFETNTVKEVEISYKRFIQNGIDIKGIILNAVVRKSANNYGYGYDYYDYSY QQGEKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | amsA |
Synonyms | amsA; Putative tyrosine-protein kinase AmsA; Amylovoran biosynthesis membrane-associated protein AmsA |
UniProt ID | Q46631 |
◆ Recombinant Proteins | ||
RFL28772PF | Recombinant Full Length Papio Hamadryas Cytochrome C Oxidase Subunit 2(Mt-Co2) Protein, His-Tagged | +Inquiry |
TRIM54-0639H | Recombinant Human TRIM54 Protein (N2-P358), Flag tagged | +Inquiry |
Col9a3-920M | Recombinant Mouse Col9a3 Protein, MYC/DDK-tagged | +Inquiry |
CLDN3-721R | Recombinant Rhesus Macaque CLDN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACADS-1342C | Recombinant Chicken ACADS | +Inquiry |
◆ Native Proteins | ||
Cp-048R | Native Rat Ceruloplasmin | +Inquiry |
Apotransferrin-39H | Native Human Apotransferrin | +Inquiry |
Lectin-1782G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Biotinylated | +Inquiry |
LH-12P | Native Porcine Luteinizing Hormone Protein | +Inquiry |
Lectin-1851U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 594 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SULT1A3-1354HCL | Recombinant Human SULT1A3 293 Cell Lysate | +Inquiry |
RNF24-2280HCL | Recombinant Human RNF24 293 Cell Lysate | +Inquiry |
Fetal Thyroid-175H | Human Fetal Thyroid Lysate | +Inquiry |
TIPRL-1058HCL | Recombinant Human TIPRL 293 Cell Lysate | +Inquiry |
DLK1-6909HCL | Recombinant Human DLK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All amsA Products
Required fields are marked with *
My Review for All amsA Products
Required fields are marked with *
0
Inquiry Basket