Recombinant Full Length Erwinia Amylovora Harpin Secretion Protein Hrpi(Hrpi) Protein, His-Tagged
Cat.No. : | RFL373EF |
Product Overview : | Recombinant Full Length Erwinia amylovora Harpin secretion protein hrpI(hrpI) Protein (P35654) (1-715aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Erwinia Amylovora |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-715) |
Form : | Lyophilized powder |
AA Sequence : | MSSLFVWLNRLAISAMQRSEVVGAAIVMSIVFMMIIPLPTGLIDVLIALNICISSLLIVL AMYLPKPLAFSTFPSVLLLTTMFRLALSISTTRQILLQQDAGHIVEAFGNFVVGGNLAVG LVIFLILTVVNFLVITKGSERVAEVAARFTLDAMPGKQMSIDSDLRAGLIEAHQARQRRE NLAKESQLFGAMDGAMKFVKGDAIAGLVIVFINMIGGFAIGVLQNGMEAGAAMHIYSVLT IGDGLIAQIPALLISLTAGMIITRVSADGQQVDANIGREIAEQLTSQPKAWIMSAAGMLG FALLPGMPTAVFVIISAIALGSGLFQLWRIKQQDSQQQADELHAQQLAPEDNGYQDLRRF NPTRAYLLQFSQEHLNSEAAESLIQHIRRLRNRLVYHFGFTLPSFDIEFSPALAADEFRF CVYEIPLVTATFAVEQLAVRTSSIEIHLADGESDGQIQPGQAERDEHHWCWLPPQHPLLQ QEDRRCWNAQQLIMLRMEQAIHQSGAQFIGLQESKSILNWLESEQPELAQELQRIMPLSR FAAVLQRLASERIPLRSVRTIAETLIEHGQHERDSAALTDFVRIALKEHICHQYQQPNGL NVWLLTPETEELLRDSLRQAQSETFFSLAQEYGINLLNQMRSAFPPYDNHHALILVAQDL RSPLRALLKDEFHAVPVLSFAELTSNVAINVLGRLDLQQSPPELQENDPCMNYAY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hrpI |
Synonyms | hrpI; Harpin secretion protein HrpI |
UniProt ID | P35654 |
◆ Recombinant Proteins | ||
Stambpl1-6160M | Recombinant Mouse Stambpl1 Protein, Myc/DDK-tagged | +Inquiry |
PDCD1LG2-206HAF647 | Active Recombinant Human PDCD1LG2 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
UREE-3548S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 UREE protein, His-tagged | +Inquiry |
IRGQ-3171H | Recombinant Human IRGQ Protein, His (Fc)-Avi-tagged | +Inquiry |
SPIRE2-15903M | Recombinant Mouse SPIRE2 Protein | +Inquiry |
◆ Native Proteins | ||
ALB-311H | Native Human Albumin, Texas Red Label | +Inquiry |
Chylomicrons-193H | Native Human Chymotrypsin | +Inquiry |
Complement C5a-54H | Native Human Complement C5a | +Inquiry |
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
RWV-307S | Native Snake RVV-V ACTIVATOR | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSR2-1698HCL | Recombinant Human SSR2 cell lysate | +Inquiry |
GNB2L1-5862HCL | Recombinant Human GNB2L1 293 Cell Lysate | +Inquiry |
K 562-257H | Human K 562 Cytoplasmic Lysate | +Inquiry |
Testis-512M | Mouse Testis Membrane Lysate | +Inquiry |
Prostate Liver Cirrhosis -403H | Human Prostate Liver Cirrhosis Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hrpI Products
Required fields are marked with *
My Review for All hrpI Products
Required fields are marked with *
0
Inquiry Basket