Recombinant Full Length Equine Herpesvirus 1 Envelope Protein Us9 Homolog (76) Protein, His-Tagged
Cat.No. : | RFL6734EF |
Product Overview : | Recombinant Full Length Equine herpesvirus 1 Envelope protein US9 homolog (76) Protein (P32513) (1-219aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | EHV1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-219) |
Form : | Lyophilized powder |
AA Sequence : | MEKAEAAAVVIPLSVSNPSYRGSGMSDQEVSEEQSAGDAWVSAAMAAAEAVAAAATSTGI DNTNDYTYTAASENGDPGFTLGDNTYGPNGAASGCPSPPSPEVVGLEMVVVSSLAPEIAA AVPADTISASAAAPATRVDDGNAPLLGPGQAQDYDSESGCYYSESDNETASMFIRRVGRR QARRHRRRRVALTVAGVILVVVLCAISGIVGAFLARVFP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | 76 |
Synonyms | 76; Envelope protein US9 homolog; Envelope protein 76; ORF76 protein |
UniProt ID | P32513 |
◆ Recombinant Proteins | ||
MRI1-6185HF | Recombinant Full Length Human MRI1 Protein, GST-tagged | +Inquiry |
PCSK7-4310R | Recombinant Rat PCSK7 Protein | +Inquiry |
TLCD2-6147Z | Recombinant Zebrafish TLCD2 | +Inquiry |
RFC4-293H | Recombinant Human RFC4 Protein, Myc/DDK-tagged | +Inquiry |
RPL10L-7721M | Recombinant Mouse RPL10L Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GG-189S | Native Sheep Gamma Globulin protein | +Inquiry |
FABP-173C | Native Canine Fatty acid Binding Protein | +Inquiry |
Lectin-1780G | Active Native Griffonia Simplicifolia Lectin I Protein, Fluorescein labeled | +Inquiry |
PRC1-5267P | Active Native Yeast PRC1 Protein | +Inquiry |
F10-302R | Native Rat Factor X | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRM2-5736HCL | Recombinant Human GRM2 293 Cell Lysate | +Inquiry |
Lymph node-332H | Human Lymph node Membrane Lysate | +Inquiry |
GLYAT-5889HCL | Recombinant Human GLYAT 293 Cell Lysate | +Inquiry |
FAM46C-6374HCL | Recombinant Human FAM46C 293 Cell Lysate | +Inquiry |
PRMT1-500HCL | Recombinant Human PRMT1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All 76 Products
Required fields are marked with *
My Review for All 76 Products
Required fields are marked with *
0
Inquiry Basket