Recombinant Full Length Epstein-Barr Virus Probable Membrane Protein (Bilf1) Protein, His-Tagged
Cat.No. : | RFL12904EF |
Product Overview : | Recombinant Full Length Epstein-Barr virus Probable membrane protein (BILF1) Protein (P03208) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HHV4 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MLSTMAPGSTVGTLVANMTSVNATEDACTKSYSAFLSGMTSLLLVLLILLTLAGILFIIF VRKLVHRMDVWLIALLIELLLWVLGKMIQEFSSTGLCLLTQNMMFLGLMCSVWTHLGMAL EKTLALFSRTPKRTSHRNVCLYLMGVFCLVLLLIIILLITMGPDANLNRGPNMCREGPTK GMHTAVQGLKAGCYLLAAVLIVLLTVIIIWKLLRTKFGRKPRLICNVTFTGLICAFSWFM LSLPLLFLGEAGSLGFDCTESLVARYYPGPAACLALLLIILYAWSFSHFMDSLKNQVTVT ARYFRRVPSQST |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BILF1 |
Synonyms | BILF1; G-protein coupled receptor BILF1 |
UniProt ID | P03208 |
◆ Recombinant Proteins | ||
YGZA-4075B | Recombinant Bacillus subtilis YGZA protein, His-tagged | +Inquiry |
REPF-1606S | Recombinant Staphylococcus aureus (isolate: MRSA37) REPF protein, His-tagged | +Inquiry |
PHF11L-4081R | Recombinant Rat PHF11L Protein, His (Fc)-Avi-tagged | +Inquiry |
AGMAT-999HF | Recombinant Full Length Human AGMAT Protein, GST-tagged | +Inquiry |
CCNB3-0656H | Recombinant Human CCNB3 Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
Immunoglobulin D-79H | Native Human Immunoglobulin D | +Inquiry |
S100A14-394H | Native Human S100A14 protein(Gly2-His104), His-tagged | +Inquiry |
PRF1-55H | Native Human Perforin | +Inquiry |
Chylomicrons-193H | Native Human Chymotrypsin | +Inquiry |
Factor Xia-65H | Native Human Factor Xia | +Inquiry |
◆ Cell & Tissue Lysates | ||
AK8-264HCL | Recombinant Human AK8 cell lysate | +Inquiry |
Stomach-761B | Bovine Stomach Membrane Lysate, Total Protein | +Inquiry |
VEGFC-1306RCL | Recombinant Rat VEGFC cell lysate | +Inquiry |
GBAS-6000HCL | Recombinant Human GBAS 293 Cell Lysate | +Inquiry |
CEP57L1-124HCL | Recombinant Human CEP57L1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BILF1 Products
Required fields are marked with *
My Review for All BILF1 Products
Required fields are marked with *
0
Inquiry Basket