Recombinant Full Length Epstein-Barr Virus Latent Membrane Protein 1(Lmp1) Protein, His-Tagged
Cat.No. : | RFL9181EF |
Product Overview : | Recombinant Full Length Epstein-Barr virus Latent membrane protein 1(LMP1) Protein (P0C741) (1-366aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HHV4 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (1-366) |
Form : | Lyophilized powder |
AA Sequence : | MERDLERGPPGPPRPPLGPPLSSSIGLALLLLLLALLFWLYIVLSNWTGGALLVLYSFALM LIIIILIIFIFRRDLLCPLGGLGLLLLMVTLLLIALWNLHGQALYLGIVLFIFGCLLVLG LWIYFLEILWRLGATIWQLLAFILAFFLAIILLIIALYLQQNWWTLLVDLLWLLLFMAIL IWMYFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQN LGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPS DSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQ LSYYD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LMP1 |
Synonyms | LMP1; BNLF1; Latent membrane protein 1; LMP-1; Protein p63 |
UniProt ID | P0C741 |
◆ Recombinant Proteins | ||
TNFRSF1A-141H | Recombinant Human TNFRSF1A Protein, His-tagged | +Inquiry |
GJC3-6381M | Recombinant Mouse GJC3 Protein | +Inquiry |
GP-794V | Recombinant EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) GP Protein, Fc-tagged | +Inquiry |
Dda1-1366M | Recombinant Mouse Dda1 Protein, Myc/DDK-tagged | +Inquiry |
PDCD1-2022H | Recombinant Human PDCD1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Actin-889P | Native Porcine Actin Protein | +Inquiry |
TSH-25H | Active Native Human Thyroid Stimulating Hormone protein | +Inquiry |
GPT-1840H | Active Native Human GPT | +Inquiry |
F10-290M | Active Native Mouse Factor X | +Inquiry |
F10-302R | Native Rat Factor X | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCHL1-535HCL | Recombinant Human UCHL1 293 Cell Lysate | +Inquiry |
MFN1-4348HCL | Recombinant Human MFN1 293 Cell Lysate | +Inquiry |
KRTAP1-1-4860HCL | Recombinant Human KRTAP1 293 Cell Lysate | +Inquiry |
AFTPH-8985HCL | Recombinant Human AFTPH 293 Cell Lysate | +Inquiry |
SLCO1C1-1687HCL | Recombinant Human SLCO1C1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LMP1 Products
Required fields are marked with *
My Review for All LMP1 Products
Required fields are marked with *
0
Inquiry Basket