Recombinant Full Length Enterococcus Faecalis Probable Protease Eep(Eep) Protein, His-Tagged
Cat.No. : | RFL158EF |
Product Overview : | Recombinant Full Length Enterococcus faecalis Probable protease eep(eep) Protein (Q9RPP2) (1-422aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterococcus faecalis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-422) |
Form : | Lyophilized powder |
AA Sequence : | MKTIITFIIVFGILVLVHEFGHFYFAKRAGILVREFAIGMGPKIFAHRGKDGTTYTIRLL PIGGYVRMAGMGEDMTEITPGMPLSVELNAVGNVVKINTSKKVQLPHSIPMEVIDFDLEK ELFIKGYVNGNEEEETVYKVDHDATIIESDGTEVRIAPLDVQFQSAKLSQRILTNFAGPM NNFILGFILFTLAVFLQGGVTDLNTNQIGQVIPNGPAAEAGLKENDKVLSINNQKIKKYE DFTTIVQKNPEKPLTFVVERNGKEEQLTVTPEKQKVEKQTIGKVGVYPYMKTDLPSKLMG GIQDTLNSTTQIFKALGSLFTGFSLNKLGGPVMMFKLSEEASNAGVSTVVFLMAMLSMNL GIINLLPIPALDGGKIVLNIIEGVRGKPISPEKEGIITLIGFGFVMVLMVLVTWNDIQRF FF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | eep |
Synonyms | eep; EF_2380; Probable protease eep |
UniProt ID | Q9RPP2 |
◆ Recombinant Proteins | ||
FBXL12-4921HF | Recombinant Full Length Human FBXL12 Protein, GST-tagged | +Inquiry |
FMR1-2874H | Recombinant Human FMR1 Protein (Met1-Gly294), N-His tagged | +Inquiry |
ATP5J-10025H | Recombinant Human ATP5J, GST-tagged | +Inquiry |
SMARCA1-4393H | Recombinant Human SMARCA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SE1890-3317S | Recombinant Staphylococcus epidermidis ATCC 12228 SE1890 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-018R | Native Rabbit Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Collagen Type IV-08H | Native Human Collagen Type IV | +Inquiry |
SV40gp6-268 | Active Native Simian virus 40 SV40gp6 protein | +Inquiry |
CRP-59C | Native Canine C-Reactive Protein | +Inquiry |
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMD1-8886HCL | Recombinant Human AMD1 293 Cell Lysate | +Inquiry |
CAMK2D-7878HCL | Recombinant Human CAMK2D 293 Cell Lysate | +Inquiry |
FCAR-1929RCL | Recombinant Rat FCAR cell lysate | +Inquiry |
ATF4-8630HCL | Recombinant Human ATF4 293 Cell Lysate | +Inquiry |
SNAPC1-1638HCL | Recombinant Human SNAPC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All eep Products
Required fields are marked with *
My Review for All eep Products
Required fields are marked with *
0
Inquiry Basket