Recombinant Full Length Enterococcus Faecalis Magnesium Transporter Mgte(Mgte) Protein, His-Tagged
Cat.No. : | RFL9438EF |
Product Overview : | Recombinant Full Length Enterococcus faecalis Magnesium transporter mgtE(mgtE) Protein (Q830V1) (1-453aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterococcus faecalis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-453) |
Form : | Lyophilized powder |
AA Sequence : | MNEGQEMEEQFALLLETLKNQQMNEFRELFLALHIYEQGQFYQSLDEKDRQHLYNYLSPK ELADMFDVIEEDNENMKDYLAEMRPSYAADMLAEMYTDNAVDLLNMLDKSQKAKYLSLLS SEEAGEIKELLHYEDETAGAIMTTEFVSIVANQTVRSAMYVLKNQADMAETIYYVYVVDQ ENHLVGVISLRDLIVNDDDTLIADILNERVISVHVGDDQEDVAQTIRDYDFLAVPVTDYD DHLLGIVTVDDIIDVIDDEAASDYSGLAGVDVEEVSENPLKAASKRLPWLITLLFLGMST ASLISNYESLVSEASILAVFISLITGTAGNAGTQSLAVAVRRLAMKDEKDSNFGRLILSE VLTGLVTGAVTGLTIMIVVGVWQHNLPLGFVIGMAMLCAITVANLAGSLIPMLMDKLGFD PAVASGPFITTLSDLTSVLIYFNIASMFMRYFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mgtE |
Synonyms | mgtE; EF_2668; Magnesium transporter MgtE |
UniProt ID | Q830V1 |
◆ Native Proteins | ||
CEACAM5-27803TH | Native Human CEACAM5 | +Inquiry |
ACE-3047R | Native rabbit ACE | +Inquiry |
NEFM-179B | Native bovine NEFM | +Inquiry |
H1F0-01B | Native Bovine H1F0 Protein | +Inquiry |
Lipoprotein-246 | Native Human Oxidized LDL (Ox-LDL) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCEB1-1189HCL | Recombinant Human TCEB1 293 Cell Lysate | +Inquiry |
XPA-262HCL | Recombinant Human XPA 293 Cell Lysate | +Inquiry |
LHX4-4749HCL | Recombinant Human LHX4 293 Cell Lysate | +Inquiry |
Gallbladder-193H | Human Gallbladder Liver Cirrhosis Lysate | +Inquiry |
Adrenal-633B | Bovine Adrenal Whole Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mgtE Products
Required fields are marked with *
My Review for All mgtE Products
Required fields are marked with *
0
Inquiry Basket