Recombinant Full Length Enterobacteria Phage Ike Attachment Protein G3P(Iii) Protein, His-Tagged
Cat.No. : | RFL1274EF |
Product Overview : | Recombinant Full Length Enterobacteria phage IKe Attachment protein G3P(III) Protein (P03663) (20-434aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterobacteria phage IKe (Bacteriophage IKe) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-434) |
Form : | Lyophilized powder |
AA Sequence : | DNWESITKSYYTGFAISKTVESKDKDGKPVRKEVITQADLTTACNDAKASAQNVFNQIKL TLSGTWPNSQFRLVTGDTCVYNGSPGEKTESWSIRAQVEGDIQRSVPDEEPSEQTPEEIC EAKPPIDGVFNNVFKGDEGGFYINYNGCEYEATGVTVCQNDGTVCSSSAWKPTGYVPESG EPSSSPLKDGDTGGTGEGGSDTGGDTGGGDTGGGSTGGDTGGSSGGGSSGGGSSGGSTGK SLTKEDVTAAIHVASPSIGDAVKDSLTEDNDQYDNQKKADEQSAKASASVSDAISDGMRG VGNFVDDFGGESSQYGTGNSEMDLSVSLAKGQLGIDREGHGSAWESFLNDGALRPSIPTG HGCTNFVMYQGSVYQIEIGCDKLNDIKSVLSWVMYCLTFWYVFQSVTSLLRKGEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | III |
Synonyms | III; Attachment protein G3P; Gene 3 protein; G3P; Minor coat protein |
UniProt ID | P03663 |
◆ Recombinant Proteins | ||
GFRA2-3162H | Recombinant Human GFRA2 protein, His-tagged | +Inquiry |
YORA-3562B | Recombinant Bacillus subtilis YORA protein, His-tagged | +Inquiry |
RFL14780SF | Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Ring Finger Protein C57A7.09 (Spac57A7.09) Protein, His-Tagged | +Inquiry |
FOXL2NB-5257H | Recombinant Human FOXL2NB Protein, GST-tagged | +Inquiry |
bSARSlS-120V | Recombinant Bat SARS-like coronavirus/HKU3-1 S(1-1190) protein | +Inquiry |
◆ Native Proteins | ||
ACTA1-853R | Native Rabbit ACTA1 Protein | +Inquiry |
Ighg2a-161M | Native Mouse Immunoglobulin G2a | +Inquiry |
LDH3-21H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
C.Pneumoniae-32 | Native Chlamydia pneumoniae Antigen | +Inquiry |
Heparin-200S | Active Native Swine Heparin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C11orf68-8338HCL | Recombinant Human C11orf68 293 Cell Lysate | +Inquiry |
ZNF259-108HCL | Recombinant Human ZNF259 293 Cell Lysate | +Inquiry |
CCDC92-164HCL | Recombinant Human CCDC92 lysate | +Inquiry |
MAB21L3-8174HCL | Recombinant Human C1orf161 293 Cell Lysate | +Inquiry |
ENG-2267MCL | Recombinant Mouse ENG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All III Products
Required fields are marked with *
My Review for All III Products
Required fields are marked with *
0
Inquiry Basket