Recombinant Full Length Enterobacteria Phage I2-2 Attachment Protein G3P(Iii) Protein, His-Tagged
Cat.No. : | RFL27053EF |
Product Overview : | Recombinant Full Length Enterobacteria phage I2-2 Attachment protein G3P(III) Protein (P15415) (20-434aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterobacteria phage I2-2 (Bacteriophage I2-2) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-434) |
Form : | Lyophilized powder |
AA Sequence : | DNWESITKSYYTGFAMSKTVESKDQDGKTVRKEVITQADLTTACNDAKASAQDVFNQMKL TFSGIWPDSQFRLVTGDTCVYNGSPSEKTESWSIRAQVEGDMQRSVPDEEPSEQTPEEIC EAKPPIDGVFNNVSKGDEGGFYINYNGCEYEATGVTVCQNDGTVCASSAWKPTGYVPESG ESSSSPVKDGDTGGTGEGGSDTGGDTGGGDTGGGSTGGDTGGSTGGGSTGGGSTGGSTGK SLTKEDVTAAIHDASPSIGDAVKDSLTEDNDQNDNQKKADEQSAKASASVSDAISDGMRG VGNFVDDLGGESSQYGIGNSEMDLSVSLAKGQLGIDLEGHGSAWESFLNDGALRPSIPSG HGCTDFVMFQGSVYQLDIGCDKLGDIKSVLSWVMYCLTFWYVFQSATSLLRKGEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | III |
Synonyms | III; Attachment protein G3P; Gene 3 protein; G3P; Minor coat protein |
UniProt ID | P15415 |
◆ Recombinant Proteins | ||
PTPN4-3524R | Recombinant Rhesus Macaque PTPN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
VAMP1-4953R | Recombinant Rhesus Macaque VAMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TBC1D24-2908H | Recombinant Human TBC1D24 protein, His-tagged | +Inquiry |
KIFC1-8807Z | Recombinant Zebrafish KIFC1 | +Inquiry |
ATAD1-834R | Recombinant Rat ATAD1 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
ECGS-32B | Native Bovine ECGS | +Inquiry |
Lecithin-08E | Native Egg Yolk Lecithin | +Inquiry |
LDL-185H | Native Human Low Density Lipoprotein, acetylated, DiI | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNKSR3-001HCL | Recombinant Human CNKSR3 cell lysate | +Inquiry |
OBFC1-3611HCL | Recombinant Human OBFC1 293 Cell Lysate | +Inquiry |
GALNTL2-6032HCL | Recombinant Human GALNTL2 293 Cell Lysate | +Inquiry |
ZSCAN12-9188HCL | Recombinant Human ZSCAN12 293 Cell Lysate | +Inquiry |
ASAH1-8670HCL | Recombinant Human ASAH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All III Products
Required fields are marked with *
My Review for All III Products
Required fields are marked with *
0
Inquiry Basket