Recombinant Full Length Enterobacter Sp. Upf0060 Membrane Protein Ent638_1931 (Ent638_1931) Protein, His-Tagged
Cat.No. : | RFL17436EF |
Product Overview : | Recombinant Full Length Enterobacter sp. UPF0060 membrane protein Ent638_1931 (Ent638_1931) Protein (A4WA77) (1-108aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterobacter sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-108) |
Form : | Lyophilized powder |
AA Sequence : | MIKTTLLFFATALCEIIGCFLPWLWLKRGASVFLLLPAGIALALFVWLLTLHPAASGRVY AAYGGVYVCTALLWLRVVDGVKLSAYDWAGALVALCGMLIIVAGWGRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ent638_1931 |
Synonyms | Ent638_1931; UPF0060 membrane protein Ent638_1931 |
UniProt ID | A4WA77 |
◆ Recombinant Proteins | ||
SEPT7-4413H | Recombinant Human SEPT7 protein, His-SUMO-tagged | +Inquiry |
TBX4-9062M | Recombinant Mouse TBX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRT6C-8214H | Recombinant Human KRT6C protein, His & T7-tagged | +Inquiry |
RNF41-2346H | Recombinant Human RNF41, His-tagged | +Inquiry |
REXO4-2733H | Recombinant Human REXO4 Protein (1-422 aa), His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
PRL-111S | Active Native Sheep Prolactin | +Inquiry |
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
COL3A1-001H | Native Human COL3A1 Protein | +Inquiry |
TF-93R | Native Rat Transferrin | +Inquiry |
TFRC-69H | Native Human Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPATA9-1530HCL | Recombinant Human SPATA9 293 Cell Lysate | +Inquiry |
SCN1B-2031HCL | Recombinant Human SCN1B 293 Cell Lysate | +Inquiry |
NEK2-1183HCL | Recombinant Human NEK2 cell lysate | +Inquiry |
SAMD12-2073HCL | Recombinant Human SAMD12 293 Cell Lysate | +Inquiry |
EP400-559HCL | Recombinant Human EP400 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ent638_1931 Products
Required fields are marked with *
My Review for All Ent638_1931 Products
Required fields are marked with *
0
Inquiry Basket