Recombinant Full Length Enterobacter Sp. Spermidine Export Protein Mdti(Mdti) Protein, His-Tagged
Cat.No. : | RFL27824EF |
Product Overview : | Recombinant Full Length Enterobacter sp. Spermidine export protein MdtI(mdtI) Protein (A4WA58) (1-109aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterobacter sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-109) |
Form : | Lyophilized powder |
AA Sequence : | MQQFEWIHAAWLAFAIVLEIIANVFLKFSDGFRRKWFGLLSIAAVLGAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNRKGWIGLVLLLAGMVMIKLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mdtI |
Synonyms | mdtI; Ent638_1912; Spermidine export protein MdtI |
UniProt ID | A4WA58 |
◆ Recombinant Proteins | ||
RNGTT-12128Z | Recombinant Zebrafish RNGTT | +Inquiry |
IL2-2741H | Active Recombinant Human IL2 | +Inquiry |
RFL25134EF | Recombinant Full Length Escherichia Coli O127:H6 Upf0059 Membrane Protein Yebn(Yebn) Protein, His-Tagged | +Inquiry |
SECD-1348S | Recombinant Streptomyces coelicolor A3(2) SECD protein, His-tagged | +Inquiry |
SLC39A7-4291R | Recombinant Rhesus monkey SLC39A7 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ORM1-27283TH | Native Human ORM1 | +Inquiry |
Collagen Type I-02M | Native Mouse Collagen Type I (Atelocollagen) Protein | +Inquiry |
Factor D-61H | Native Human Factor D | +Inquiry |
FGG -41B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
VZV-04 | Native Varicella Zoster Virus (VZV) Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAK4-3456HCL | Recombinant Human PAK4 293 Cell Lysate | +Inquiry |
IL17RA-2640HCL | Recombinant Human IL17RA cell lysate | +Inquiry |
CCL17-535MCL | Recombinant Mouse CCL17 cell lysate | +Inquiry |
RGS5-2371HCL | Recombinant Human RGS5 293 Cell Lysate | +Inquiry |
UBAP1-599HCL | Recombinant Human UBAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mdtI Products
Required fields are marked with *
My Review for All mdtI Products
Required fields are marked with *
0
Inquiry Basket