Recombinant Full Length Encephalitozoon Cuniculi Uncharacterized Membrane Protein Ecu05_0140(Ecu05_0140) Protein, His-Tagged
Cat.No. : | RFL10569EF |
Product Overview : | Recombinant Full Length Encephalitozoon cuniculi Uncharacterized membrane protein ECU05_0140(ECU05_0140) Protein (Q8SVN2) (1-458aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Encephalitozoon cuniculi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-458) |
Form : | Lyophilized powder |
AA Sequence : | MQAISSSTLKGKVYTPIPPSESVFVYISLFLLQIFKNSRLELVLRLLKKHCIRRPIGRTC TPLSFCVPFHRQTSEKKNKRKFGIADLPLLLFQKGDRLSLHNKENLRINLAVSKFLKKYI ISQNYKYPKNPMSIMKSKIAKTLVVVVVAIAIFTLVLLMLWEGPLGTLTEENLTELNGEV PFRFKDSGSNEEGKDVTLSKFFVCLNKVLRSADDSLSSYLCCGETSEEEGESKKGKYVKN AITEARNMMFRVKDSKDVILEILKKGDKNRNELAETVSNAFSAVETSEGSDQESEGADEQ GKIEKLNTALAELYIWIWLKGIPEEDKRTLQFRKTYKENQSVKNLLDGLDEENREVAEST ILVKVGKKEDSMHVIEHILTSIFQANGYMEKGSIKQAYLSAKASVAAAGGSLGKKVSEVS DNEGKGLIDSLFGMIGWRNNSNNNSSVSKKKEEQGVNS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ECU05_0140 |
Synonyms | ECU05_0140; Uncharacterized membrane protein ECU05_0140 |
UniProt ID | Q8SVN2 |
◆ Recombinant Proteins | ||
VOM1R96-6193R | Recombinant Rat VOM1R96 Protein, His (Fc)-Avi-tagged | +Inquiry |
SYK17089H | Recombinant Human SYK (356-635) Protein | +Inquiry |
IMMP1L-5153H | Recombinant Human IMMP1L Protein, GST-tagged | +Inquiry |
Tnfsf13-696M | Active Recombinant Mouse Tnfsf13 | +Inquiry |
ROR1-6078C | Recombinant Chicken ROR1 | +Inquiry |
◆ Native Proteins | ||
LDL-400H | Native Human Low Density Lipoprotein, High Oxidized | +Inquiry |
Fgb -68R | Native Rat Fibrinogen | +Inquiry |
Cytochrome c-023H | Native Human Cytochrome c Protein | +Inquiry |
Chitin-001C | Native Crawfish Chitin | +Inquiry |
ORM1-110H | Native Human Alpha 1 Acid Glycoprotein (A1AGP) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CWC27-7174HCL | Recombinant Human CWC27 293 Cell Lysate | +Inquiry |
TLE2-1050HCL | Recombinant Human TLE2 293 Cell Lysate | +Inquiry |
PROC-852HCL | Recombinant Human PROC cell lysate | +Inquiry |
RNFT2-550HCL | Recombinant Human RNFT2 lysate | +Inquiry |
YY1AP1-227HCL | Recombinant Human YY1AP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ECU05_0140 Products
Required fields are marked with *
My Review for All ECU05_0140 Products
Required fields are marked with *
0
Inquiry Basket