Recombinant Full Length Emericella Nidulans Palmitoyltransferase Pfa5(Pfa5) Protein, His-Tagged
Cat.No. : | RFL36777EF |
Product Overview : | Recombinant Full Length Emericella nidulans Palmitoyltransferase pfa5(pfa5) Protein (Q5B433) (1-486aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Emericella nidulans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-486) |
Form : | Lyophilized powder |
AA Sequence : | MAGQPDRRINLAVARVIPVVLFGIIIYSCYVITKPLCIDYLIDPLPKYNRPSRVGAGAAI LVVFYILLLFVIITYVRLLYTVVYNPDLLPRSQAADQQSTPAKRSKSRSRRKGHGHGHRK SKSDEVSDKPVSDVERALDYNAGPMVLPWDTAGLEYFYKKDVFVCQPDGRPIYCSKCCHY KPDRTHHCREVDRCVRKMDHFCPWVGGVVSETSFKFFIQFVFYTALFCMTVLIVCAIYTA ELRQDVSLISGSRNMLIISRLVMLTLIGLSDSLQLAAFNLTTIENLNRRSAVWTLAIRVP NHMISRIQPGTRWAPTFRTITYPLPPVPPPLSGMPTQPATGEGDNPYSPPPVPSTDPSAE QHIFAILQTLPGENPFALGSPLKNLQQVLGHSIIDWLLPIKRSPCADHSSAESEFVMGPV VSRLKKEAGLESKDAAAGSITTKHKNSSYNSSPSAPADKRSKRKQKRGKHHHHHHHHRHS STTGTT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pfa5 |
Synonyms | pfa5; AN4697; Palmitoyltransferase pfa5; Protein fatty acyltransferase 5 |
UniProt ID | Q5B433 |
◆ Recombinant Proteins | ||
Zfand1-7074M | Recombinant Mouse Zfand1 Protein, Myc/DDK-tagged | +Inquiry |
TMA16-7748Z | Recombinant Zebrafish TMA16 | +Inquiry |
FANCG-3833H | Recombinant Human FANCG Protein, GST-tagged | +Inquiry |
ESD-2147R | Recombinant Rat ESD Protein | +Inquiry |
CXCL10-4342C | Recombinant Caprine CXCL10 Protein | +Inquiry |
◆ Native Proteins | ||
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
HPX-29307TH | Native Human HPX | +Inquiry |
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
Pertussis-37 | Native Pertussis Toxin Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetus-188M | Mouse Fetus (17 Day Fetus) Membrane Lysate | +Inquiry |
KIF1B-4951HCL | Recombinant Human KIF1B 293 Cell Lysate | +Inquiry |
KRTCAP2-371HCL | Recombinant Human KRTCAP2 lysate | +Inquiry |
ZNF784-10HCL | Recombinant Human ZNF784 293 Cell Lysate | +Inquiry |
CCL24-437HCL | Recombinant Human CCL24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pfa5 Products
Required fields are marked with *
My Review for All pfa5 Products
Required fields are marked with *
0
Inquiry Basket