Recombinant Full Length Electron Transport Complex Protein Rnfa(Rnfa) Protein, His-Tagged
Cat.No. : | RFL32497EF |
Product Overview : | Recombinant Full Length Electron transport complex protein RnfA(rnfA) Protein (A1ABH2) (1-193aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-193) |
Form : | Lyophilized powder |
AA Sequence : | MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTMAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rsxA |
Synonyms | rsxA; rnfA; Ecok1_15180; APECO1_710; Ion-translocating oxidoreductase complex subunit A; Rsx electron transport complex subunit A |
UniProt ID | A1ABH2 |
◆ Native Proteins | ||
Tnni3-7423M | Native Mouse Tnni3 Protein | +Inquiry |
Lectin-1862W | Active Native Wheat Germ Agglutinin Protein, Rhodamine labeled | +Inquiry |
Lectin-1868W | Active Native Wisteria Floribunda Lectin Protein, Agarose bound | +Inquiry |
Gliadin-168W | Native Wheat Gliadin | +Inquiry |
SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF828-2HCL | Recombinant Human ZNF828 293 Cell Lysate | +Inquiry |
CDR2-7607HCL | Recombinant Human CDR2 293 Cell Lysate | +Inquiry |
FGFR2-2578HCL | Recombinant Human FGFR2 cell lysate | +Inquiry |
IK-343HCL | Recombinant Human IK lysate | +Inquiry |
RGS2-2378HCL | Recombinant Human RGS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All rsxA Products
Required fields are marked with *
My Review for All rsxA Products
Required fields are marked with *
0
Inquiry Basket