Recombinant Full Length Elaphodus Cephalophus Nadh-Ubiquinone Oxidoreductase Chain 4L(Mt-Nd4L) Protein, His-Tagged
Cat.No. : | RFL28965EF |
Product Overview : | Recombinant Full Length Elaphodus cephalophus NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L) Protein (Q9B987) (1-98aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Elaphodus cephalophus (Tufted deer) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-98) |
Form : | Lyophilized powder |
AA Sequence : | MSLVYMNIMTAFTVSLTGLLMYRSHLMSSLLCLEGMMLALFVMATLTILNSHFTLASMMP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MT-ND4L |
Synonyms | MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L |
UniProt ID | Q9B987 |
◆ Recombinant Proteins | ||
FAM47E-1455H | Recombinant Human FAM47E | +Inquiry |
RFL30267MF | Recombinant Full Length Mouse C-C Chemokine Receptor Type 11(Ccrl1) Protein, His-Tagged | +Inquiry |
Dhx32-181M | Recombinant Mouse Dhx32 Protein, MYC/DDK-tagged | +Inquiry |
RFL15229PF | Recombinant Full Length Prochlorococcus Marinus Protein Crcb Homolog 2(Crcb2) Protein, His-Tagged | +Inquiry |
AZI2-1053H | Recombinant Human AZI2 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-318B | Native Bovine Collagen Type IV | +Inquiry |
MFGE8-288B | Native Bovine Lactadherin | +Inquiry |
PNLIP-8205H | Native Human Pancreas Lipase | +Inquiry |
Lectin-1772E | Active Native Erythrina Cristagalli Lectin Protein, Agarose bound | +Inquiry |
PLG-268B | Active Native Bovine glu-Plasminogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
TWSG1-1547MCL | Recombinant Mouse TWSG1 cell lysate | +Inquiry |
RAPGEF1-2522HCL | Recombinant Human RAPGEF1 293 Cell Lysate | +Inquiry |
FANCD2OS-113HCL | Recombinant Human FANCD2OS lysate | +Inquiry |
DSG1-512HCL | Recombinant Human DSG1 cell lysate | +Inquiry |
FAM96A-6338HCL | Recombinant Human FAM96A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MT-ND4L Products
Required fields are marked with *
My Review for All MT-ND4L Products
Required fields are marked with *
0
Inquiry Basket