Recombinant Full Length Echinops Telfairi Nadh-Ubiquinone Oxidoreductase Chain 4L(Mt-Nd4L) Protein, His-Tagged
Cat.No. : | RFL9021EF |
Product Overview : | Recombinant Full Length Echinops telfairi NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L) Protein (Q9G385) (1-98aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Echinops telfairi (Lesser hedgehog tenrec) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-98) |
Form : | Lyophilized powder |
AA Sequence : | MPVIYINLIAAFFMAFMGLLIYRSHLMSSLLCLEGMMLSLFILNSTLALSMHFTLYSMMP IILLVFAACEAALGLSLLVMVSNTYGLDYVQNLNLLQC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MT-ND4L |
Synonyms | MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L |
UniProt ID | Q9G385 |
◆ Recombinant Proteins | ||
SYN1-6386H | Recombinant Human SYN1 Protein, His-tagged | +Inquiry |
GJA3-11837Z | Recombinant Zebrafish GJA3 | +Inquiry |
Tyk2-7543M | Recombinant Mouse Tyk2 protein(884-1174aa), His&Myc-tagged | +Inquiry |
PARK2-30785TH | Recombinant Human PARK2 | +Inquiry |
RFL35588MF | Recombinant Full Length Pasteurella Haemolytica Leukotoxin Translocation Atp-Binding Protein Lktb(Lktb) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Hb-901M | Native Mouse Hemoglobin Protein | +Inquiry |
SERPINC1 -50P | Native Porcine Antithrombin III | +Inquiry |
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
LDHC-28045TH | Native Human LDHC | +Inquiry |
IgG-343M | Native MONKEY IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
NTF3-3671HCL | Recombinant Human NTF3 293 Cell Lysate | +Inquiry |
TRIM25-788HCL | Recombinant Human TRIM25 293 Cell Lysate | +Inquiry |
ZNF285A-101HCL | Recombinant Human ZNF285A 293 Cell Lysate | +Inquiry |
WBP5-364HCL | Recombinant Human WBP5 293 Cell Lysate | +Inquiry |
Heart-206H | Human Heart Interventricular Septum (Diseased) Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MT-ND4L Products
Required fields are marked with *
My Review for All MT-ND4L Products
Required fields are marked with *
0
Inquiry Basket