Recombinant Full Length Eastern Equine Encephalitis Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL34919EF |
Product Overview : | Recombinant Full Length Eastern equine encephalitis virus Structural polyprotein Protein (Q306W5) (802-1242aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | EEEV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (802-1242) |
Form : | Lyophilized powder |
AA Sequence : | YEHTAVMPNKVGIPYKALVERPGYAPVHLQIQLVTTKIIPSANLEYITCKYKTKVPSPVV KCCGATQCTSKQHPDYQCQVFAGVYPFMWGGAYCFCDTENTQMSEAYIERAEECSVDQAK AYKVHTGTVQAVVNITYGSVSWRSADVYVNGETPAKIGDAKLTIGPLSSAWTPFDSKVVV YGHEVYNYDFPEYGTGKAGSFGDLQSRTLTSNDLYANTNLKLQRPQPGVVHTPYTQAPSG FERWKKDRGAPLNDIAPFGCTIALDPLRAENCAVGNIPLSIDIPDAAFTRISETPTVSDL ECKITECTYASDFGGIATVAYKASKAGNCPIHSPSGIAVIKENDVTLADSGSFTFHFSTA SIHPAFKMQICTSVVTCKGDCKPPKDHIVDYPAQHTETFTSAVSATAWSWLKVLVGSTSA FIVLGLIATAVVALVLFTHKH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Eastern equine encephalitis virus Structural polyprotein |
Synonyms | Structural polyprotein; p130 |
UniProt ID | Q306W5 |
◆ Recombinant Proteins | ||
SBSN-7916M | Recombinant Mouse SBSN Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM220A-253C | Recombinant Cynomolgus Monkey FAM220A Protein, His (Fc)-Avi-tagged | +Inquiry |
TG-3207H | Recombinant Human TG, GST-tagged | +Inquiry |
HDAC3-3229H | Recombinant Human HDAC3 Protein (Met1-Gln376), N-His tagged | +Inquiry |
YWHAH-12380Z | Recombinant Zebrafish YWHAH | +Inquiry |
◆ Native Proteins | ||
IgA-246H | Native Hamster Immunoglobulin A | +Inquiry |
DIP-25 | Active Native NADPH dehydrogenase | +Inquiry |
CKM-5305H | Native Human creatine kinase, muscle | +Inquiry |
ALOD-36 | Active Native Alcohol oxidase | +Inquiry |
LDH-121B | Active Native Bovine Lactate Dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Skin-144R | Rat Skin Tissue Lysate | +Inquiry |
GCHFR-692HCL | Recombinant Human GCHFR cell lysate | +Inquiry |
Intestine-827M | Mini pig Intestine Membrane Lysate, Total Protein | +Inquiry |
MT1X-4097HCL | Recombinant Human MT1X 293 Cell Lysate | +Inquiry |
ZIK1-163HCL | Recombinant Human ZIK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Eastern equine encephalitis virus Structural polyprotein Products
Required fields are marked with *
My Review for All Eastern equine encephalitis virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket