Recombinant Full Length Eastern Equine Encephalitis Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL1867EF |
Product Overview : | Recombinant Full Length Eastern equine encephalitis virus Structural polyprotein Protein (P27284) (800-1240aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | EEEV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (800-1240) |
Form : | Lyophilized powder |
AA Sequence : | YEHTAVMPNKVGIPYKALVERPGYAPVHLQIQLVNTSIIPSTNLEYITCKYKTKVPSPVV KCCGATQCTSKPHPDYQCQVFTGVYPFMWGGAYCFCDTENTQMSEAYVERSEECSIDHAK AYKVHTGTVQAMVNITYGSVSWRSADVYVNGETPAKIGDAKLIIGPLSSAWSPFDNKVVV YGHEVYNYDFPEYGTGKAGSFGDLQSRTSTSNDLYANTNLKLQRPQAGIVHTPFTQAPSG FERWKRDKGAPLNDVAPFGCSIALEPLRAENCAVGSIPISIDIPDAAFTRISETPTVSDL ECKITECTYASDFGGIATLPTNPVKQETVQFILHQVLQLLKRMTSPLLRAGSFTFHFSTA NIHPAFKLQVCTSGVTCKGDCKPPKDHIVDYPAQHTESFTSAISATAWSWLKVLVGGTSA FIVLGLIATAVVALVLFFHRH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Eastern equine encephalitis virus Structural polyprotein |
Synonyms | Structural polyprotein; p130 |
UniProt ID | P27284 |
◆ Recombinant Proteins | ||
VSTM2L-4833H | Recombinant Human V-Set And Transmembrane Domain Containing 2 Like, His-tagged | +Inquiry |
DNAJB2-3979HF | Recombinant Full Length Human DNAJB2 Protein, GST-tagged | +Inquiry |
SRGN-2369H | Recombinant Human SRGN protein(Met1-Leu158), His&Myc-tagged | +Inquiry |
CDH16-2090H | Recombinant Human CDH16 protein, His & T7-tagged | +Inquiry |
FSH-129H | Active Recombinant Human Follicle Stimulating Hormone protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1736C | Active Native Canavalia ensiformis Concanavalin A Protein, Rhodamine labeled | +Inquiry |
IgG-7439M | Native Mouse IgG Fc Protein | +Inquiry |
TFRC-69H | Native Human Apotransferrin | +Inquiry |
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
C3-8391H | Native Human C3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAVCR1-2141HCL | Recombinant Human HAVCR1 cell lysate | +Inquiry |
RALBP1-2542HCL | Recombinant Human RALBP1 293 Cell Lysate | +Inquiry |
PLEKHB2-3114HCL | Recombinant Human PLEKHB2 293 Cell Lysate | +Inquiry |
TNFAIP8L2-894HCL | Recombinant Human TNFAIP8L2 293 Cell Lysate | +Inquiry |
CA9-3065HCL | Recombinant Human CA9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Eastern equine encephalitis virus Structural polyprotein Products
Required fields are marked with *
My Review for All Eastern equine encephalitis virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket